KEGG   Janthinobacterium agaricidamnosum: GJA_5167Help
Entry
GJA_5167          CDS       T03157                                 

Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jag  Janthinobacterium agaricidamnosum
Pathway
jag00071  Fatty acid degradation
jag00072  Synthesis and degradation of ketone bodies
jag00280  Valine, leucine and isoleucine degradation
jag00310  Lysine degradation
jag00362  Benzoate degradation
jag00380  Tryptophan metabolism
jag00620  Pyruvate metabolism
jag00630  Glyoxylate and dicarboxylate metabolism
jag00640  Propanoate metabolism
jag00650  Butanoate metabolism
jag00900  Terpenoid backbone biosynthesis
jag01100  Metabolic pathways
jag01110  Biosynthesis of secondary metabolites
jag01120  Microbial metabolism in diverse environments
jag01130  Biosynthesis of antibiotics
jag01200  Carbon metabolism
jag01212  Fatty acid metabolism
jag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GJA_5167
   00630 Glyoxylate and dicarboxylate metabolism
    GJA_5167
   00640 Propanoate metabolism
    GJA_5167
   00650 Butanoate metabolism
    GJA_5167
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GJA_5167
   00072 Synthesis and degradation of ketone bodies
    GJA_5167
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GJA_5167
   00310 Lysine degradation
    GJA_5167
   00380 Tryptophan metabolism
    GJA_5167
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GJA_5167
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GJA_5167
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GJA_5167
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jag04147]
    GJA_5167
Enzymes [BR:jag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GJA_5167
Exosome [BR:jag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GJA_5167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDG85764
UniProt: W0VAB9
Position
complement(5548431..5549609)
Genome map
AA seq 392 aa AA seqDB search
MDDVVIVAAGRTAVGKFGGSLAKIPASELGAHVIKGLLAQTGIDPNLIGEAILGQVLTAA
VGQNPARQAVIKAGLPTSVPAYTINKVCGSGLKATHLAAQSIKCGDASIIIAGGQENMSA
APHAMNGSRDGFRMGDFKMVDTMIVDGLWDVYNQYHMGITAENVARKYEITRAEQDEFAL
QSQLKAEAAQKAGKFKDEILPLEIANKKGTVVFDSDEYIKPGSTLESLAGLRPAFNKEGS
VTAGNASGLNDGAAAVIMMSAKVAKELGLKPLARIKAYASSGLDPALMGMGPVSASRLCL
KKAGWTHEELDLMEINEAFAAQAIAVNKEMGWDTSKINVNGGAIAIGHPIGASGARILVT
LVHEMIRRDAKKGLASLCIGGGMGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgtcgttatcgtggccgctggccgtaccgcagtcggcaaattcggcggcagc
ctggccaagatccccgcgtccgagctgggcgcgcatgtaatcaaaggtttgctggcgcaa
accggcatcgatccgaacctgatcggcgaagcgatcctgggccaggtactgaccgcggcg
gtgggccagaacccggcgcgccaggcagtcatcaaggccggcttgcccacctcggttccg
gcctacaccatcaacaaggtgtgcggcagcggcttgaaagccacccacctggcggcgcaa
tcgatcaagtgcggcgacgccagcatcatcatcgccggcggccaggaaaacatgagcgcc
gcgccgcatgcgatgaacggctcgcgcgacggtttccgcatgggcgatttcaagatggtc
gacaccatgatcgtcgacggcctgtgggacgtctacaaccagtaccacatgggcatcacg
gcggaaaacgtcgccaggaaatacgaaatcacccgcgccgagcaagatgaattcgcgctg
caatcgcaactgaaggcggaagccgcgcaaaaggccggcaagttcaaggatgaaatcctg
ccgctggaaatcgccaataaaaaaggcaccgtggtgttcgacagcgatgaatacatcaag
ccgggttcgacgctggaatcgctggccggcctgcgccccgcgttcaacaaggaaggcagc
gtcaccgccggcaacgcgtccggcctgaacgacggcgccgccgccgtcatcatgatgtcg
gccaaggttgccaaggaactgggcttgaagccgctggcgcgcatcaaggcctacgcttcg
tccggcctggacccggcgctgatgggcatgggcccggtatcggcgtcgcgcctgtgcctg
aaaaaggccggctggacccacgaagaactggacttgatggaaatcaatgaagcgttcgcc
gcgcaagcgatcgccgtcaacaaggaaatgggctgggataccagcaagatcaacgtcaac
ggcggcgcgatcgcgatcggccatccgatcggcgcctccggcgcgcgcatcctggtgacg
ctggtccacgaaatgatacgccgcgacgccaagaaaggcctggcgtcgctgtgcatcggc
ggcggcatgggcgtggcgctggcgatcgaacgcgactga

DBGET integrated database retrieval system