KEGG   Janthinobacterium sp. 17J80-10: EKL02_01940Help
Entry
EKL02_01940       CDS       T05896                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj00900  Terpenoid backbone biosynthesis
jaj01110  Biosynthesis of secondary metabolites
jaj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EKL02_01940
Enzymes [BR:jaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     EKL02_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: QAU33033
UniProt: A0A410UNY1
Position
455555..456835
Genome map
AA seq 426 aa AA seqDB search
MRIDSRLPNFRALDPAARLDEIVNKVGLTPEERALISEPNALPLETANGMVENVIGKFEL
PYSVAGYVQINGRDVLVPMVVEEPSVVAAASFMSKLIRDAGGFQTSSSGPIMRAQVQIMG
ITDPYGARHALLNHRQEIIEMANQRDKVLIGLGGGCRDIEVHIFPDTPRGPMVVMHLIVD
VRDAMGANTVNTMAETVAPRVEEITGGKVRLRILSNLADLRLARARVQIPAALLKTDKYS
GEDVINGIVDAYTFAAVDPYRAATHNKGIMNGIDPIIVATGNDWRAVEAGAHAYACRGGR
YTSLTTWEISKEGDLVGTIEMPMPVGLVGGATKTHPLARLSLKIMQLKSAQELAEIAVAV
GLAQNMGALRALATEGIQRGHMALHARNIAIAAGAKGDLIDKIAQKMAAAKDVRTDYAIE
LLKEFQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgattcccgcctgcccaacttccgcgccctggatcctgcggcccgcctcgat
gaaattgtgaataaagtcggcttgaccccggaagagcgtgcgctaatttccgagccgaat
gctttgcccttggaaacagccaatggcatggtcgaaaacgtcatcggcaagttcgagttg
ccttattcggtggccgggtacgttcagatcaatggccgggatgttttggtgccgatggtc
gttgaagagccatccgtggtggcggcggcgtcgttcatgtcaaagctgatccgcgacgcc
ggcggcttccagacctccagcagtgggccgatcatgcgcgcccaggtgcaaatcatggga
ataacggacccctatggcgcgcgccatgcgctgctgaaccacaggcaggaaatcattgaa
atggcaaaccagcgcgacaaggtgctgatcggcctgggcggcggttgccgcgacatcgaa
gtgcatattttccctgacacgccgcggggcccgatggtggtgatgcacctgatcgtcgat
gtgcgtgatgcgatgggcgccaacaccgtcaatacgatggcggaaacggtcgcgccgcgt
gtggaggaaatcacgggcggcaaggtgcgcctgcgcattctgtccaatctggctgacctg
cggctggcgcgcgcccgggtacagattcccgcggcgcttctcaaaaccgacaagtacagc
ggcgaagatgtcatcaacggcatcgtcgatgcttacacgtttgcggccgtcgacccctat
cgtgccgccacgcataacaagggcatcatgaatggcatcgatcccatcatcgtcgcaaca
ggcaacgactggcgtgctgtcgaggccggcgcccatgcctatgcctgccgtggcggccgc
tatacctccctgaccacctgggaaatttccaaagagggcgacctggtgggcacgatcgag
atgccgatgccggtcggcctcgtcgggggcgccaccaagacgcatccgctggcccggctg
tcgctcaagatcatgcaattgaaatcggcgcaggaattggccgaaattgccgtcgcggtc
ggcctggcgcaaaacatgggtgccctgcgcgcactggcgaccgaagggatccagcgtggc
cacatggcgctgcatgcccgcaatatcgcgattgccgccggcgccaaaggcgatttgatc
gacaagatcgcgcaaaaaatggccgccgcaaaagatgtgcgcaccgactatgcgatcgaa
ttactgaaagaattccagtaa

DBGET integrated database retrieval system