KEGG   Janthinobacterium sp. 17J80-10: EKL02_16550Help
Entry
EKL02_16550       CDS       T05896                                 

Definition
(GenBank) aminoglycoside phosphotransferase
  KO
K07102  N-acetylmuramate 1-kinase [EC:2.7.1.221]
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj00520  Amino sugar and nucleotide sugar metabolism
jaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EKL02_16550
Enzymes [BR:jaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.221  N-acetylmuramate 1-kinase
     EKL02_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH EcKinase LAGLIDADG_3 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: QAU35645
UniProt: A0A410UWA7
Position
3720474..3721502
Genome map
AA seq 342 aa AA seqDB search
MSTSNSPDLRLIQLKQWIGTLAEPALAPDSLRVASADASFRRYFRIDGAGSNATYIVMDA
PPPQEDVRPFIHVAQLFGQTGVSVPQILAQDAEQGFLLLSDLGNTTYLNQLNADTAHQLY
LDAIDSLVLLQVHSQPGVLPEYDRALLSRELQLFPEWYIGKHLGATLTAAQQTDLDKVFE
VLLANNLAQPQVYVHRDYHSRNLMVLSKGNPGILDFQDAVYGPITYDLVSLLRDAYIQWD
EEMVLDWAIRYWERARRAGLPVNPDIDGFYRDFEFMGVQRHLKVLGIFARLYHRDGKDGY
LKDLPLVMEYTRKAAARYRELIPLIRLLDVLEERGPRVGYTF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcaaattcccctgacttgcgtttaatacaactaaaacagtggattggcacg
ctcgccgagcccgcgctggcgcccgattcgctgcgtgtcgcctcggccgatgccagtttc
cgccgttatttccgcatcgacggcgccggcagcaatgccacctatatcgtcatggatgcc
ccgccgccccaggaagacgtgcgtccgttcatccacgtggcgcaactgttcggccagacc
ggcgtgtcggtgccacaaattctggcacaggatgccgaacaaggcttcttgctgctgtcg
gacctcggcaataccacttatctgaaccagctcaatgcggatacggcgcaccagttgtat
cttgatgccatcgactcgctggtgctgttgcaagtccatagccagccgggcgtactgccg
gaatacgatcgggccctgctttcacgcgaattgcagcttttcccggaatggtatatcggc
aagcacctgggcgcgaccctgactgcggcccagcaaaccgacctcgacaaggtatttgaa
gtactgctggccaataacctcgcccagccacaagtgtacgtacatcgggattaccactcg
cgcaacctgatggtcctgtccaaaggcaatcctggcatcctcgacttccaggatgcggtc
tatggcccgatcacctatgacctggtgtcgctgctgcgcgacgcctacatccagtgggat
gaagaaatggtgctcgactgggcgatccgctactgggagcgcgcgcgccgcgccggactg
ccggtgaatcccgacatcgacggcttttaccgcgatttcgaattcatgggcgtgcagcgc
cacctgaaagtgctgggcattttcgcccgcctgtaccaccgcgacggcaaggatggctac
ctgaaggacctgccgctggtgatggaatacacgcgcaaggccgccgcccgctaccgcgaa
ctaatcccgctgatccgcctgctcgacgtgctggaagagcgtggccccagagttgggtat
accttttaa

DBGET integrated database retrieval system