KEGG   Janthinobacterium sp. 17J80-10: EKL02_16880Help
Entry
EKL02_16880       CDS       T05896                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj00730  Thiamine metabolism
jaj00900  Terpenoid backbone biosynthesis
jaj01100  Metabolic pathways
jaj01110  Biosynthesis of secondary metabolites
jaj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EKL02_16880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EKL02_16880
Enzymes [BR:jaj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     EKL02_16880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh Transketolase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: QAU35705
UniProt: A0A410UWH2
Position
complement(3783838..3785712)
Genome map
AA seq 624 aa AA seqDB search
MDLLKKINSPADLRTLARADLPPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVF
NTPEDRIVWDVGHQTYPHKILTGRRDRMATLRQFNGISGFPRRDESEYDTFGTAHSSTSI
SAALGMALAAKTKGENRHAIAVIGDGAMTAGMAFEALNNAGVYEDINLLVILNDNDMSIS
PPVGALNRYLARLMSGKFYAAARNVGKTVLPAPMLELAKRLEEHAKGMIMPATMFEEFGF
NYIGPIDGHDLESLVPTLQNLKALKGPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAE
GIKPAKAGKLTYTQVFGDWLCDQAAADKRLIGVTPAMREGSGMVAFEQRFPDRYYDVGIA
EQHAVTFAAGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFALDRAGLVGADGA
THAGNYDLAFLRCIPNMVVMAASDENECRQMLSTAFQYNGPAAVRYPRGAGVGAAVQKDL
QTLPVGKGEIRREGKGIAILAFGTMLAPALAAGDALNATVANMRFVKPIDADLVRQLAQT
HDALVTVEEGALMGGAGSAVAEALAEAGIVKPVLHLGLPDKFIDHGDAAQLLAMCGLDAA
GIEAAVRRRFGKDDKGEPRLVVNN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggacttgctaaaaaaaatcaacagccccgccgacctgcgtaccctggcgcgcgccgac
ctgccgccgctggcggacgaactgcgcgccttcgtgctcgactcggtctccaagaccggc
ggccacctgtcgtccaacctgggcacggtggagctgacgattgcgctgcattatgtcttt
aacaccccggaagaccgcatcgtctgggatgtcggccaccagacctatccgcacaagatc
ctgacgggccggcgcgaccgcatggccacgctgcgccagttcaacggcatttccggcttt
ccgcgccgcgacgagagcgaatacgataccttcggcacggcccactcctcgacctcgatt
tcggcggcgctcggcatggcgctggcggcaaagaccaagggcgagaaccgccatgccatc
gccgtcattggcgatggcgccatgaccgccggcatggctttcgaagcgctgaacaacgcc
ggggtgtacgaagacatcaacctgctggtgatcctgaacgacaatgacatgtcgatctcg
ccgccggtgggcgcgctgaaccggtatcttgcgcgcctgatgtccggcaagttctatgcc
gccgcgcgcaacgtcggcaagaccgtgctgccggcgccgatgctggaactggccaagcgc
ctggaagaacatgccaagggcatgatcatgccggcgaccatgttcgaggaattcggtttc
aactacatcggccccatcgatggccacgacctcgaatcgctggtgccgaccctgcaaaac
ctgaaggcattgaagggcccgcaattcctgcacgtggtgaccaaaaaaggccagggctac
aagctggccgaagccgacccggtgctctaccatggccccggcaagttcaaccccgccgaa
ggcatcaagcccgccaaggccggcaagctgacctacacgcaagttttcggcgactggctg
tgcgaccaggccgcggccgacaagcgcctgatcggcgtgacgccagccatgcgcgaaggc
tccggcatggtcgcgttcgagcagcgcttccccgaccgttactatgacgtcggcatcgcc
gagcagcatgccgtgacgtttgccgcaggcctggcgtgcgagggcctgaagccggtggtg
gcgatttattcgaccttcctgcagcgcggctacgaccagctgatccacgacgtcgccctg
caaaacctggacgtgacctttgcgctggaccgcgccggcctggtcggcgccgacggcgcc
acccacgccggcaattacgacctggccttcctgcgctgcatccccaacatggtggtcatg
gcggcgtccgatgaaaacgagtgccggcagatgctctccaccgctttccaatataatggt
cctgctgccgtgcgctatccgcgcggcgcaggcgtcggcgctgcggtgcagaaggatttg
cagaccctccctgtgggcaagggtgaaatccgccgcgaaggcaaaggcattgccatcctc
gcctttggcaccatgctggcgccggcgctggccgcaggcgacgccctgaatgcgacggtg
gccaacatgcgcttcgttaagcccatcgatgcggatctggtgcggcaactggcccagacc
cacgatgcgctggtgacggtggaagagggtgcgctgatgggcggcgccggttcggcggtt
gccgaggcgctggccgaagcgggcatcgtcaagccggttctgcacctgggcttgccggac
aagttcatcgaccatggcgacgcagcccagctgctggccatgtgcgggctggacgccgcc
ggcatcgaagctgccgtgcgacggcgcttcggcaaggatgacaagggcgagccgcgcctg
gtcgtcaacaactga

DBGET integrated database retrieval system