KEGG   Janthinobacterium sp. 17J80-10: EKL02_17985Help
Entry
EKL02_17985       CDS       T05896                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EKL02_17985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:jaj03011]
    EKL02_17985
Ribosome [BR:jaj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EKL02_17985
  Bacteria
    EKL02_17985
  Archaea
    EKL02_17985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QAU35898
UniProt: A0A410UX12
Position
complement(4000274..4000603)
Genome map
AA seq 109 aa AA seqDB search
METKAILRGVRLSEQKGRLVADQIRGKKVEQALNILAFSPKKGAAIIKKVLESAIANAEH
NDGADIDELKVKTIYVEQGTVLKRFTARAKGQGNRISKQSCHIYVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagctattctccgcggcgtacgcctgtcggaacaaaaaggccgcttggtt
gctgatcagattcgcggcaaaaaagtcgagcaagccttgaacattctggctttcagcccg
aaaaaaggtgcagcgatcatcaagaaagttctggagtccgcaattgcgaacgccgagcac
aacgatggtgctgatatcgacgagctgaaggtcaagacgatttacgttgagcaaggtacg
gtgctgaagcgtttcaccgcccgtgctaaaggccaaggtaatcgtatttccaagcaatcc
tgtcacatttacgtgactgtcggtaactaa

DBGET integrated database retrieval system