KEGG   Janthinobacterium sp. LM6: BZG29_02280Help
Entry
BZG29_02280       CDS       T04756                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:jal00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZG29_02280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:jal02000]
    BZG29_02280
Enzymes [BR:jal01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     BZG29_02280
Transporters [BR:jal02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    BZG29_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 SbcCD_C AAA_29 AAA_30 RsgA_GTPase AAA_13 AAA_25 Zeta_toxin MukB AAA_23 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AQR71712
UniProt: A0A1S6FDL2
Position
531121..532671
Genome map
AA seq 516 aa AA seqDB search
MKTQAHHTAAPAPLLELRGISKSFPGVKALSDVALRLYPGEVHTLMGQNGAGKSTLIKVL
TGVYTPDSGQILLDGKPIAPASTSDAQALGISTVYQEVNLCPNLSVAENIFIGRYPRRFG
GCFGPIDWRSMQQQARALLQQLQIDIDVTAQLSSFPLAIQQMVAISRALNISARVLILDE
PTSSLDEAEVNLLFSVLRRLREQGMAILFVTHFLDQTYAISDRITVMRNGEREGEYACSE
LSRLALVNKMIGVAADTQAQELDLAQEAGAASFGPAVLEATGLGRKGALLPMDFHIRQGE
LLGLAGLLGSGRTELARLLFGADKADSGTITMQGQPRHFNVPRDAIARDIGFCSEDRKHE
GAILSLSVRENIILALQARTGLLRAIPFKRQQALADEYVKALGIKTASIETPIGSLSGGN
QQKALLARWLVTSPAMLILDEPTRGIDVRAKQEIMSYVSKLCRKGMAILFISSELPEVLR
CSDRIVVMRDRKACGDYARGELDDCSVLQVIAGDAT
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcaagcgcatcacactgccgcgccagctcccttgctggagttgcgcggcatc
agcaagtcctttcccggcgtcaaagccctcagcgatgttgccctgcgcctgtatccgggt
gaagtgcacactttgatggggcaaaacggcgcgggaaagtcgaccctgatcaaggtgctg
acgggcgtctacacgcccgacagcggccaaattttactcgatggcaaacccatcgctccg
gcgtccacctcggacgcgcaggcactcggcatcagcaccgtgtaccaggaagtcaatctg
tgcccgaacctgtcggtggcggaaaacatttttatcggccgctacccgcgtcgctttggc
ggctgctttggcccgatcgactggcgttccatgcagcaacaggcgcgtgccttgctgcag
caattacagatcgatatcgatgtcacggcgcaactgtccagctttccgctggccatccag
caaatggtggccatctcgcgcgcgctgaacatttcagcccgcgtgctgatcctcgacgaa
cccacgtccagcctggacgaggcggaagtcaatctgctgttctccgtgctgcgccgcctg
cgcgagcaaggcatggcgatcctgttcgtgacccacttcctggaccagacctacgccatt
tccgaccgcatcaccgtcatgcgcaacggcgagcgcgaaggagagtatgcgtgcagcgag
ctgtcgcgcctggcgctggtgaacaagatgatcggcgtggcggccgacacgcaggcgcaa
gagcttgatctggcgcaagaagcgggcgcggccagtttcggtcccgccgtgctggaagcc
accggactgggccgcaagggcgccttgctgcccatggatttccacatccgccagggcgaa
ttgctgggcctggccggtttgctcggttcgggccgcacggaactggcgcgcttgctgttc
ggcgccgacaaggccgactcgggcacgatcaccatgcagggccagccgcgccacttcaat
gtgccgcgcgacgcgattgcccgcgacatcggcttttgctcggaagaccgcaagcacgag
ggcgcgatcctgtcgctgtccgtgcgcgaaaacatcatattggccttgcaagcccgcacg
ggcttgctgcgcgccatcccgttcaaacgccagcaggcgctggccgatgaatacgtgaaa
gcgctgggcatcaagacggccagcatcgaaaccccgatcggcagcctgtcgggcgggaat
caacagaaggccttgctggcgcgctggctggtgacgtcgccggccatgctgattttagac
gaaccgacgcgcggcatcgacgtgcgcgccaagcaggaaatcatgagctatgtaagcaag
ctgtgccgcaagggcatggcgattctgttcatctcgtccgaattgccggaagtgctgcgc
tgcagcgaccgcatcgtcgtcatgcgcgaccgcaaggcctgcggcgactatgcgcgtggc
gagctggacgattgttccgtgctgcaagtgattgccggagatgccacatga

DBGET integrated database retrieval system