KEGG   Janthinobacterium sp. LM6: BZG29_15625Help
Entry
BZG29_15625       CDS       T04756                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00450  Selenocompound metabolism
jal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BZG29_15625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jal03016]
    BZG29_15625
Enzymes [BR:jal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BZG29_15625
Transfer RNA biogenesis [BR:jal03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BZG29_15625
 Prokaryotic type
    BZG29_15625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AQR69601
UniProt: A0A1S6F7I8
Position
3579139..3580203
Genome map
AA seq 354 aa AA seqDB search
MSDSAVTPNTPIRLTEFAHGGGCGCKIAPGVLADILKGSGGFPLPKELLVGIETSDDAAV
YQLNDEQALIATTDFFMPIVDDPFDFGRIAATNAISDVYAMGGTPIMALALVGMPINKLP
VETIGLILKGGETICAQAGIPIAGGHTIDSVEPIYGLVVLGLVHPSQVKRNAGARAGDKL
VLGKPIGVGILSAALKKNALDADGYASLIANTTKLNTPGKKLALLDGVHALTDVTGFGLL
GHTLELARGAKLQARIAMADVPLLLQVQQLAQNGNITGASGRNWQGYGAQVQLDDGLSAI
DKAILTDPQTAGPLLVACAPEAVEQVLAIFRAEGFGDAVVIGEMQDGNTGVSVY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatagcgcagtaacaccaaatacccccatccgattgaccgaatttgcccatggc
ggcggctgcggctgcaagatcgcgcccggcgtgctggccgacatcttaaaaggcagcggc
ggctttcccctgccgaaagaattgctggttggcatagaaacctcggatgacgcggccgtc
taccagctcaacgacgagcaggcgctgatcgccaccacggatttcttcatgcccatcgtc
gacgacccgttcgacttcggccgcatcgccgccaccaacgccatttccgacgtgtacgcc
atgggcggcacgcccatcatggcgctggccctggtgggcatgccgatcaacaagctgccg
gtggaaaccatcggcctcatcttaaagggtggcgaaaccatctgcgcccaggccggcatc
cccatcgcgggcggccacaccatcgattccgtcgagccgatctatggcctggtcgtgctg
ggcctcgtgcacccgtcgcaggtgaagcgcaacgctggcgcgcgcgccggcgataaactg
gtgctgggcaagccgatcggcgtgggcattttgtcggccgcgctgaagaagaatgcgctg
gacgcggatggctacgcctcgctgatcgccaacaccaccaaattgaataccccgggcaag
aaactggccctgctggacggcgtgcatgcgctgacggacgtgacgggcttcggcttgctg
ggccacaccctggaactggcgcgcggcgccaagttgcaggcgcgcatcgccatggctgac
gtgccgctgctgctgcaagtgcagcaactggcgcaaaacggcaacatcacgggcgcgtcc
ggccgcaactggcagggctacggcgcgcaagtgcagctcgacgacggcttgagcgccatc
gacaaggcgatcctgacggacccgcaaacggccggccccctgctggtggcgtgcgcgccg
gaagccgtcgagcaagtactggcgattttccgcgccgaaggctttggcgacgccgtcgtc
atcggcgagatgcaggatggcaataccggggtttccgtatattaa

DBGET integrated database retrieval system