KEGG   Janthinobacterium sp. LM6: BZG29_15905Help
Entry
BZG29_15905       CDS       T04756                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00071  Fatty acid degradation
jal00072  Synthesis and degradation of ketone bodies
jal00280  Valine, leucine and isoleucine degradation
jal00310  Lysine degradation
jal00362  Benzoate degradation
jal00380  Tryptophan metabolism
jal00620  Pyruvate metabolism
jal00630  Glyoxylate and dicarboxylate metabolism
jal00640  Propanoate metabolism
jal00650  Butanoate metabolism
jal00900  Terpenoid backbone biosynthesis
jal01100  Metabolic pathways
jal01110  Biosynthesis of secondary metabolites
jal01120  Microbial metabolism in diverse environments
jal01130  Biosynthesis of antibiotics
jal01200  Carbon metabolism
jal01212  Fatty acid metabolism
jal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG29_15905
   00630 Glyoxylate and dicarboxylate metabolism
    BZG29_15905
   00640 Propanoate metabolism
    BZG29_15905
   00650 Butanoate metabolism
    BZG29_15905
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BZG29_15905
   00072 Synthesis and degradation of ketone bodies
    BZG29_15905
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZG29_15905
   00310 Lysine degradation
    BZG29_15905
   00380 Tryptophan metabolism
    BZG29_15905
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BZG29_15905
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BZG29_15905
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZG29_15905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jal04147]
    BZG29_15905
Enzymes [BR:jal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BZG29_15905
Exosome [BR:jal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZG29_15905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQR69649
UniProt: A0A1S6F7T8
Position
complement(3637865..3639043)
Genome map
AA seq 392 aa AA seqDB search
MNEAVIVSTARTGLAKSWKGAFNMTHGATLGGHVLAAAVERARIEAEEVEDVLVGCAFPE
GATGGNIARQVALRGGCPVTTAGMTVNRFCSSGLQAIALAAQRIIAGEGDIYAAGGVESI
SCVQNEMNTHMYRDVWLQQHKPEVYWPMLQTAETVAKRYQISRERQDAYGAQSQQRAASA
LAAGLFDAEIVPMTTIMGVADKASGMLVSREVTIAADEGIRADTTYDGVAKIRPAIPGGV
ISAGNASQFSDGASMAIVMNAKVAEAKGLQPLGIFRGFAVAGCEPDEMGIGPVFAIPKLL
KKAGLTVADIGLWELNEAFAVQVLYCADTLGIPMDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEVL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagccgtcatcgtatcgaccgcccgcacgggcctggccaagtcctggaagggc
gcgttcaacatgacgcatggcgccaccctgggcggccatgtgctggcggccgccgtcgag
cgcgcgcgcatcgaggcggaggaagtggaagacgtgctggtcggctgcgcctttcccgaa
ggcgccacgggcggcaacatcgcgcgccaggtggccttgcgcggcggctgccccgtcacg
acggccggcatgaccgtcaaccgtttttgttcctcgggcttgcaggccatcgccctggcg
gcgcagcgcatcatcgccggcgaaggcgatatctatgcggcgggcggcgtggaatcgatt
tcctgtgtgcaaaacgagatgaatacgcatatgtaccgcgacgtctggctgcagcagcac
aagccggaagtgtactggcccatgctgcagacggccgagaccgtggccaagcgctaccag
atttcgcgcgagcgccaggacgcctatggcgcgcaaagccagcagcgcgcagcaagcgcc
ctggctgccggcctgttcgacgcggaaatcgtgccgatgaccaccatcatgggcgtggcc
gacaaggccagcggcatgctggtgtcgcgcgaagtgacgattgccgccgacgaaggcatc
cgcgcggacacgacgtatgacggcgtggcgaagatccgcccggccattccgggcggcgtc
atcagcgccggcaacgccagccagttttccgacggcgcttcgatggccatcgtcatgaat
gcgaaagtggccgaggcgaaaggactgcagccgctgggcatcttccgcggcttcgccgtg
gccggctgcgaacccgatgaaatgggcatcggcccagtgtttgccatcccgaaactgctg
aaaaaagcgggtttgacggtggccgacatcggcctgtgggaactcaatgaagcgtttgcc
gtgcaagtgctgtattgcgccgacaccctgggcatcccgatggaccgcctgaacgtcaac
ggcggcgcgattgccgtcggccacccgtacggcgtgtcgggtgcgcgcctgacgggccac
gccttgatcgaaggcaagcgccgcggcgtcaaatacgtggtggtcaccatgtgcatcggc
ggcgggcagggcgccgccgggctgttcgaagtgctgtga

DBGET integrated database retrieval system