KEGG   Janthinobacterium sp. LM6: BZG29_17705Help
Entry
BZG29_17705       CDS       T04756                                 

Definition
(GenBank) fructose reductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
jal  Janthinobacterium sp. LM6
Brite
KEGG Orthology (KO) [BR:jal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BZG29_17705
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     BZG29_17705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AQR69960
UniProt: A0A1S6F8W4
Position
complement(4039935..4040936)
Genome map
AA seq 333 aa AA seqDB search
MKKTGWILVGASTVAREWMVDAIRQQGDAEVLAVVSTDAARGAAFAEQFGIAASYTDLDA
ALAHPGADAVYISTTNEWHMSQTLQAARAGKHVLCEKPLALNLDDARRMVDGCADAGVVL
GINHHLRNAASHGKVRELIRAGEIGQPLYCRVLHANNLPQHLRGWRLDAPESGGVTLDMF
VHDVDTLRFLLDSEPRHVTACATSGGMTVAGLEEGLMAVIEFDNGTLVQVHDAFNAPHSL
SGVEIIGSKGTIFATGVMTQRPVGSISLTRDGGSVDIPVEHENLYVRSVRAFQRAMRGEG
QPAATGDDGMRALATALAAQQASRSHQRVTLAG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaccggatggattttggtcggcgccagcaccgtggcgcgcgaatggatggtc
gacgcgatccgccagcagggcgatgccgaagtgctggccgtggtcagcacggatgccgcg
cgcggcgccgcctttgcggagcagttcggcatagccgccagctacacggacctcgatgcg
gcgctggcccatccgggcgcggacgccgtgtacatcagcaccaccaacgaatggcatatg
tcgcagaccttgcaggcggcgcgcgcgggcaagcacgtgctgtgcgagaagccgctggcg
ctgaacctggacgacgcgcgccgcatggtcgacggttgcgccgatgcgggcgtggtgctg
gggattaaccatcacctgcgcaacgccgccagccacggcaaggtgcgcgagctgatacgc
gccggcgagatcggccagcccctgtattgccgcgtgctgcacgcgaacaacctgccgcag
cacctgcgcggctggcgcctggatgcgccggaatcgggcggcgtcacgctcgacatgttc
gtgcacgacgtcgacaccctgcgcttcctgctcgactcggagccgcgccacgtcactgcc
tgcgccaccagcggcggcatgacggtggccgggctggaagagggcctgatggccgtcatc
gagttcgataacggcaccctggtgcaggtgcacgacgcgttcaatgcgccgcattcgctg
tccggcgtggaaatcatcggcagcaagggcaccatcttcgccaccggcgtgatgacgcag
cgccccgtcggcagcatcagcctgacgcgcgacggcggcagcgtcgacatccccgtcgag
catgaaaacctgtatgttcgctcggtgcgcgccttccagcgcgccatgcgcggcgaaggg
cagccggccgccaccggcgacgacggcatgcgcgcgctggcgacggcattggcggcgcag
caggctagccgcagccaccagcgcgtgaccctggccggctga

DBGET integrated database retrieval system