KEGG   Janthinobacterium sp. LM6: BZG29_17715Help
Entry
BZG29_17715       CDS       T04756                                 

Definition
(GenBank) bifunctional glyoxylate/hydroxypyruvate reductase B
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00030  Pentose phosphate pathway
jal00480  Glutathione metabolism
jal01100  Metabolic pathways
jal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BZG29_17715
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BZG29_17715
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     BZG29_17715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 DUF4440 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AQR69962
UniProt: A0A1S6F8J7
Position
complement(4042007..4042966)
Genome map
AA seq 319 aa AA seqDB search
MKKHVVVYKKLAEPLLARLRAECEVTYFEAIDAGNRAAFAAAIRGAHGLLGASVRLDREL
LDPALDLRIISTISVGVDQFDVDYLRERGILLANTPDVLTETTADTIFALILASARRVVE
LAEFVKAGRWTRSVGESQYGVNVHGKTIGMLGMGRIGRAVARRAALGFGMQVLYVNGEAV
PEVEAALGARQVALDDLLAASDFVCVVLPLTAQTERMMGRREFALMRPGAIFINGSRGRI
VDEAALIEALQQGTIHGAGLDVFEREPLAPDNPLPRMANVVALPHIGSATHETRYAMAQQ
AVDNLLAGLRGERPRHLVS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacatgtggttgtgtataaaaagctggccgaaccgctgctggcgcgcctgcgc
gccgaatgcgaggtgacgtatttcgaggcgatcgacgcgggcaaccgcgccgcgtttgcc
gccgccatccgcggcgcgcatggcttgctgggcgccagcgtgcgcctggaccgcgaactg
ctggatccggccttggacctgcgcatcatttccaccatttcggtgggcgtcgaccagttc
gacgtcgattacctgcgcgaacggggcatcttgctggccaatacgccggacgtgctgacg
gaaacgacggccgacacgatcttcgcgctgatcctcgccagcgcacggagggtcgtcgaa
ctggccgaattcgtcaaggcggggcgctggacgcgcagcgtgggcgaaagccagtacggc
gtcaacgtgcacggcaagaccatcggcatgctgggcatgggccgcatcggccgcgccgtc
gcccgccgcgccgcgctgggcttcggcatgcaggtgctgtacgtgaacggcgaggcggtg
cccgaggtggaagcggcgctgggcgcgcgccaggtggcgctcgacgacttgctggccgca
tccgatttcgtctgcgtggtgctgccgctgacggcgcagacggaacgcatgatgggccgg
cgcgaattcgcgctgatgcgccccggcgccatcttcatcaacggttcgcgcgggcgcatc
gtcgacgaggcggcgctgatcgaggcgctgcagcagggcaccatccacggcgccggtctc
gacgtgttcgagcgcgagccgctggcgccggacaatccgctgccgcgcatggccaacgtg
gtggcgctgccgcatatcggctcggccacgcacgaaacgcgctacgccatggcgcagcag
gccgtggacaacctgctggccggcctgcgcggcgagcgtccgcgccacctggtcagctaa

DBGET integrated database retrieval system