KEGG   Jannaschia sp. CCS1: Jann_0157Help
Entry
Jann_0157         CDS       T00330                                 

Gene name
bchM
Definition
(GenBank) Mg-protoporphyrin IX methyl transferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00860  Porphyrin and chlorophyll metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jann_0157 (bchM)
Enzymes [BR:jan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     Jann_0157 (bchM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS PCMT FtsJ NodS Ubie_methyltran TPMT Methyltransf_2 RrnaAD Methyltransf_32 CMAS Methyltransf_9 Cons_hypoth95 PrmA Methyltransf_15 baeRF_family10 TehB MethyltransfD12 DREV
Motif
Other DBs
NCBI-ProteinID: ABD53074
UniProt: Q28W38
Position
complement(146694..147383)
Genome map
AA seq 229 aa AA seqDB search
MVATPTYDATRDRVEAYFDRTATKTWERLTSDAPVSGVRRTVRAGRDRMRALMLSRLPKD
LSGRRVLDAGCGTGAMTEVLAARGAEVVAIDISPQLIDIAAKRLPEDLVPRVTFQSGDML
SANLGAFDHVMAMDSMIYYTAPDLGRALAGLSERCPHIVFTVAPRTPFLMAFFGLGKLFP
RADRSPVMIPHAPKRISEKLLINQCDRTLLKLEQVTSGFYISSCLEMRA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaacgcccacatatgacgccacccgcgaccgggtcgaggcctatttcgaccgc
accgcgaccaagacgtgggaacggctgacgtccgacgcgcccgtctctggcgtgcgccgg
accgtgcgtgcgggccgtgaccggatgcgcgcgctgatgctgtcgcgcctgcccaaggat
ctgtcggggcgtcgcgtgttggatgcgggctgtggcaccggcgcgatgaccgaggttctc
gccgcccgtggcgctgaggttgtggctattgatatctctccgcagctgatcgacatcgcc
gccaagcgtctgcccgaggatttggtgccgcgcgtgacgttccaatcgggcgacatgctg
tccgccaatctgggtgcgtttgatcacgtcatggcgatggattcgatgatctattacacc
gcgcccgatctgggtcgcgcgctggcaggcttgtctgagcgctgtccccatatcgtcttt
accgttgcgccccgcacgcctttcctgatggccttttttggccttggcaagctgttcccc
cgcgccgaccgttcgcccgtgatgatcccccatgcgccaaagcgcatatctgagaaatta
cttataaatcaatgcgatagaaccctgctcaagcttgagcaagtcacgtccggcttctac
atctcttcctgtctggagatgcgcgcgtga

DBGET integrated database retrieval system