KEGG   Jannaschia sp. CCS1: Jann_0158Help
Entry
Jann_0158         CDS       T00330                                 

Gene name
bchL
Definition
(GenBank) protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00860  Porphyrin and chlorophyll metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jann_0158 (bchL)
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Jann_0158 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB MipZ SRP54 AAA_26 CBP_BcsQ AAA_25 NB-ARC RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABD53075
UniProt: Q28W37
Position
complement(147384..148343)
Genome map
AA seq 319 aa AA seqDB search
MLDDKTPPAARAAMREAAGLEARGLKSPPILKGQDGEGSLQVHQSDDMKIEGAKVFAVYG
KGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTGMLQPTVIDILKSVDFHAEE
LRPEDFVTQGYNGVQCIEAGGPPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVLFDVLGDV
VCGGFAAPLQHADRALIVTANDFDSIYAMNRIIAAVQAKSKNYNVRLAGCVANRSKDTDE
VDRYCDVVGFKRIGHMPDVDAIRRSRLKKKTLFEMPDEEDIVQCRAEYIRLAEKLYAGTD
PLAPAPLEDRDIFELLGFD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgacaaaacaccccccgccgcccgggccgccatgcgcgaagccgcagggctt
gaggcgcgtggtctcaaatcgcccccgatcctgaaaggtcaggacggggagggatcgttg
caggtgcatcaatccgacgacatgaagatcgaaggcgcgaaggtgttcgccgtctatggc
aaaggcgggatcggcaaatcgacgacctcgtcaaacctgtctgcggcgttttccaagctg
ggcaagaaggtcctgcaaatcggctgtgaccccaagcatgacagcacgttcaccctgacg
ggcatgttgcagcccacggtgatcgacatcctgaaatccgtggatttccatgccgaagaa
ttgcggccagaggatttcgtgacgcagggctacaacggtgtgcagtgtatcgaggccggt
ggcccgcctgctggcaccggctgcggtggctatgtggtgggtcagacggtgaagttgttg
aagcaacatcacctgctggaagacaccgatgtcgtgctcttcgacgtgctgggcgatgtc
gtctgcggtggctttgcagcccccctgcaacacgccgaccgcgcgctgatcgtgaccgcc
aatgatttcgacagcatctatgcgatgaaccggatcattgccgccgttcaggccaagtcg
aagaattacaacgtgcggcttgcgggctgtgtcgccaaccgctccaaggacaccgatgag
gtggaccggtattgtgatgtggtgggcttcaagcgcatcggtcatatgcccgacgtggat
gccatccgccgctcgcgcctgaagaaaaagaccctgttcgagatgcctgatgaggaagac
atcgtgcaatgccgcgccgaatacatccgtctggccgagaagctctatgcgggcaccgat
ccgctggcccccgcgccgctggaagaccgcgatatctttgaattgctggggttcgattga

DBGET integrated database retrieval system