KEGG   Jannaschia sp. CCS1: Jann_0535Help
Entry
Jann_0535         CDS       T00330                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00010  Glycolysis / Gluconeogenesis
jan00020  Citrate cycle (TCA cycle)
jan00620  Pyruvate metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
Module
jan_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_0535
   00020 Citrate cycle (TCA cycle)
    Jann_0535
   00620 Pyruvate metabolism
    Jann_0535
Enzymes [BR:jan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Jann_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ABD53452
UniProt: Q28V10
Position
complement(524727..526334)
Genome map
AA seq 535 aa AA seqDB search
MTHALSGGRVNPAHTLDQQGITGLGSVYYNLLEPALMQAAVERGEGRIGKGGTFLVSTGQ
FTGRSPNDKFVVRTPEVEDHIWWDNNAPMTPDAFDALYSDMLEHMKGGDYYVQDLFGGAD
AEHRLDVRVVSELAWHNLFIRHLLRRPDAEELASFVPEFTIINCPSFKADPARHGTNSET
VIALNFERKLILIGNTEYAGENKKSVFTLLNYILPGKGVMAMHCSANHAIGNPDDSAVFF
GLSGTGKTTLSADPGRTLIGDDEHGWSDSGIFNFEGGCYAKTINLREDAEPEIFATTAKF
STVIENMVYDEDTLELDFDDDSLTANMRCAYPIEMISNASATGLGGSPKNIVMLTCDAFG
VLPPIARLSPAQAMYHFLSGFTAKVAGTERGVTEPTPTFSTCFGAPFMPRRPEVYGDLLR
QKIAAHGATCWLVNTGWTGGAFGTGSRMPIRATRALLTAALNGTLNAGDFRRDPNFGFDV
PVHCHGVADLLLDPRRTWDRPDSYDRQAQRLVDMFSDNFAQYVDHIDDDVKAAAI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgccctttcagggggacgcgtgaaccccgcacatacgcttgaccagcaaggt
atcacagggctcggctcggtctattacaacctgctggaacccgccctgatgcaggccgcc
gtcgaacgcggcgaagggcgcatcggcaaggggggcacgttcctggtctccaccggtcag
ttcaccggccgctcccccaacgacaagttcgtcgtccgcacgcccgaggttgaagatcat
atctggtgggacaacaacgcgcccatgacccccgacgcatttgatgcgctctacagcgat
atgctggagcacatgaagggcggcgactattacgtgcaggatctgttcggcggcgcagat
gcggagcatcggcttgacgtgcgcgtcgtgtctgaactcgcctggcacaacctcttcatc
cggcatctgctgcgccgtcccgatgcggaggagcttgcgtccttcgtgccggaattcacc
atcatcaactgcccgagcttcaaggcggacccagcgcgtcacggtacaaattccgagact
gtgatcgcgctgaatttcgagcggaaactgatcctgatcggcaataccgaatatgcgggc
gagaacaagaaatccgtgttcacgctgctgaactacattctgcccggcaaaggtgtgatg
gccatgcattgctcggccaaccacgccatcggcaatccggatgacagcgcggtgttcttc
ggcctctcgggcaccggcaagacgaccctgtccgccgatcccggtcggacgctgatcggc
gatgatgaacatggttggtccgatagcggcatcttcaattttgaagggggctgctatgcc
aagaccatcaacctgcgcgaagacgcggagcctgaaatctttgcaacgacggccaagttt
tccaccgtgatcgagaacatggtctatgacgaagatacgctggagctggactttgacgac
gacagcctgacggccaatatgcgctgtgcctacccgatcgagatgatctccaacgcgtcc
gccaccgggcttggcggctcgcccaagaacatcgtgatgctgacctgcgatgcctttggc
gttctgcccccgattgctcggctgtcgcccgcccaggcgatgtaccacttcctgtctggc
tttaccgcaaaggtcgccgggacagagcgtggcgtgaccgagccgacgcccaccttctcc
acctgtttcggcgcgcccttcatgccgcgtcgacccgaggtctatggcgatctgttgcgc
cagaagattgccgcccatggcgccacctgttggctggtgaacacgggctggaccggcggc
gcgttcgggaccggctcccgcatgccgatccgggccacaagggcgttgctgacggcagcc
ctcaacgggacgttgaacgccggagatttccgccgcgatccaaacttcggctttgatgta
ccagtccattgtcacggcgtggcagatctgctgttggacccccgccgcacctgggaccgc
cccgacagctatgaccgtcaggctcaacgcctggtcgacatgttctccgataactttgcc
caatatgtcgaccacatcgacgacgatgtgaaagcggctgccatctaa

DBGET integrated database retrieval system