KEGG   Jannaschia sp. CCS1: Jann_0590Help
Entry
Jann_0590         CDS       T00330                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
jan  Jannaschia sp. CCS1
Pathway
jan03010  Ribosome
Brite
KEGG Orthology (KO) [BR:jan00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Jann_0590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:jan03011]
    Jann_0590
Ribosome [BR:jan03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Jann_0590
  Bacteria
    Jann_0590
  Archaea
    Jann_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 RecO_N
Motif
Other DBs
NCBI-ProteinID: ABD53507
UniProt: Q28UV5
Position
575643..576023
Genome map
AA seq 126 aa AA seqDB search
MSKDKNPRRVADNEAMAKLRMLKTSPQKLNLVAGLIRGQKVEKALTDLTFSKKRIAVDVK
KCLQSAIANAENNHGLDVDELIVAEAWVGKNLVMKRGRPRARGRFGKILKPFSELTITVR
QVEETS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggataagaacccccgccgcgtggcggacaatgaggcgatggccaagctgcgt
atgctgaaaaccagcccgcagaagctgaaccttgttgccggtctgatccgtggccagaag
gttgaaaaggccctgacggacctgaccttctccaagaagcggatcgctgtagacgtgaag
aaatgccttcagtccgccatcgccaacgccgagaacaaccacggtctggacgtcgacgag
ctgatcgttgccgaggcctgggttggcaagaacctggtcatgaaacgcggtcgcccgcgg
gcccgtggacggttcggtaaaattctcaagccgttctcagaattgacgatcacggttcgc
caggtcgaggagacttcgtaa

DBGET integrated database retrieval system