KEGG   Jannaschia sp. CCS1: Jann_0650Help
Entry
Jann_0650         CDS       T00330                                 

Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00071  Fatty acid degradation
jan00072  Synthesis and degradation of ketone bodies
jan00280  Valine, leucine and isoleucine degradation
jan00310  Lysine degradation
jan00362  Benzoate degradation
jan00380  Tryptophan metabolism
jan00620  Pyruvate metabolism
jan00630  Glyoxylate and dicarboxylate metabolism
jan00640  Propanoate metabolism
jan00650  Butanoate metabolism
jan00900  Terpenoid backbone biosynthesis
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
jan01212  Fatty acid metabolism
jan02020  Two-component system
Module
jan_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Jann_0650
   00630 Glyoxylate and dicarboxylate metabolism
    Jann_0650
   00640 Propanoate metabolism
    Jann_0650
   00650 Butanoate metabolism
    Jann_0650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Jann_0650
   00072 Synthesis and degradation of ketone bodies
    Jann_0650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Jann_0650
   00310 Lysine degradation
    Jann_0650
   00380 Tryptophan metabolism
    Jann_0650
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Jann_0650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Jann_0650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Jann_0650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jan04147]
    Jann_0650
Enzymes [BR:jan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Jann_0650
Exosome [BR:jan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Jann_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABD53567
UniProt: Q28UP5
Position
621182..622387
Genome map
AA seq 401 aa AA seqDB search
MAEAFICDYIRTPIGRFGGALAKVRADDLGAVPLAALMARNSGVDWAAVDDIYYGCANQA
GEDNRNVARMSALLAGLPEAVPGTTINRLCGSGMDAIIAAARAIKAGETELMIAGGVESM
SRAPFVMPKADTAFSRKAEIYDTTIGWRFVNPVMKAQYGIESMPETAENVAEDYTVSRAD
QDAFAARSQAKAGAAMASGRLAEEITPVTIPRRKGEPVVVSEDEHPRPDTDVAALSKLRA
PFRDGGSVTAGNASGVNDGAAALVIASEAAAVTHGLTPIARIVGGAVAGVAPRIMGIGPL
PASQKLMARLGLTISDFDVIELNEAFAAQGLAVTRGLGIADDDARVNPNGGAIALGHPLG
MSGARIAGSAALEMKLRGGTRALATMCIGVGQGIAVALEAV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcatttatctgcgattacatccgcacaccgattggacggttcggtggcgcg
ttggccaaggtgcgcgccgatgacctgggcgcggtgccgctggcggcgctgatggcgcgg
aattcaggcgtggattgggcggcggtggacgacatttactatggctgcgccaaccaggcg
ggcgaggataaccgcaacgtggcgcgcatgtcggcgcttctggcgggcttgccggaggcg
gtgccggggaccacgatcaaccgcctgtgcggctctggcatggacgcgatcatcgcagcg
gcgcgggcgatcaaggcgggcgagacggagttgatgattgccggcggggtcgaaagcatg
tcccgcgcgcccttcgtgatgcccaaggcggacacggcgttttcccgcaaggccgagatc
tacgacacgactatcggctggcgcttcgtgaacccggtgatgaaggcgcaatacgggatc
gagtccatgccagagacggcagagaatgtggccgaagactacaccgtgtcccgcgcggat
caggatgcgtttgccgcgcggtcgcaagccaaggccggggcggccatggcgtcggggcgg
ttggcggaggaaatcacgccggtgacgatcccgcgtcgcaagggcgagcctgtggttgtc
tctgaggatgagcacccgaggccggacacggacgtggccgcgctgtcgaagttgcgcgcg
ccgtttcgggatgggggcagtgtgacggcgggcaatgcgtccggggtgaacgacggggca
gcggcgctggtgatcgcgtcagaggcggctgcggtgacgcatggattgacgcccatcgcg
cggattgtgggcggggccgtggcaggcgtggccccccggatcatggggatcgggccgctc
cccgcctcgcaaaagctgatggcgcgcctgggcctgaccattagcgatttcgacgtgatc
gagttgaacgaggccttcgcggcgcagggtctggccgtcacgcggggccttgggattgct
gacgatgatgcccgtgtgaatcccaatggcggcgcgatagccctggggcatcccttgggg
atgtcgggcgcccgcatcgccggatctgccgcgctggagatgaagttgcgtggtggcacg
cgcgccttggcgacgatgtgcatcggcgtgggtcaggggatcgctgtggcgctggaggcg
gtttga

DBGET integrated database retrieval system