KEGG   Jannaschia sp. CCS1: Jann_0810Help
Entry
Jann_0810         CDS       T00330                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00020  Citrate cycle (TCA cycle)
jan00190  Oxidative phosphorylation
jan00650  Butanoate metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
Module
jan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jan_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jann_0810
   00650 Butanoate metabolism
    Jann_0810
  Energy metabolism
   00190 Oxidative phosphorylation
    Jann_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABD53727
UniProt: Q28U85
Position
complement(770651..771022)
Genome map
AA seq 123 aa AA seqDB search
MAYVTDRKRVSGLGSAKGGTAQHWTMTVTSVALLILTPFFLAIIGSALGSDHADVIATLG
KPVPALIVAAYLVVGMHHLRYGMQTLLEDYTHGLTKKVSIIVTTILSYGLAAGGLVALMQ
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgtaaccgaccgcaaacgcgtttccggcctcggctccgccaaggggggcacc
gcgcagcactggacgatgaccgtcacctccgtggcgcttctgatcctcacgccgttcttt
ctggccatcatcggcagcgcccttggcagcgaccacgccgacgtcatcgccacgctcggc
aagcccgtgcctgcgctgatcgtcgcggcctaccttgtcgtgggcatgcaccacctacgt
tatgggatgcagaccctgctggaagattacacccacgggctgaccaaaaaggtctcgatc
atcgtgaccaccatactcagctacgggctggccgctggcggccttgtggccctgatgcaa
atcgcgctttga

DBGET integrated database retrieval system