KEGG   Jannaschia sp. CCS1: Jann_1733Help
Entry
Jann_1733         CDS       T00330                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00010  Glycolysis / Gluconeogenesis
jan00051  Fructose and mannose metabolism
jan00562  Inositol phosphate metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
jan01230  Biosynthesis of amino acids
Module
jan_M00002  Glycolysis, core module involving three-carbon compounds
jan_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_1733
   00051 Fructose and mannose metabolism
    Jann_1733
   00562 Inositol phosphate metabolism
    Jann_1733
Enzymes [BR:jan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Jann_1733
Exosome [BR:jan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Jann_1733
  Exosomal proteins of bladder cancer cells
   Jann_1733
  Exosomal proteins of melanoma cells
   Jann_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABD54650
UniProt: Q28RL2
Position
complement(1726402..1727148)
Genome map
AA seq 248 aa AA seqDB search
MARKLAAGNWKMNGVEADLAEVDALGEAVAAANCDVLLCPPATLIAPMAKRAGLMDLYVG
GQTCHTAASGAHTGDVSAAMLADAGASHVILGHSERRADHGERSEDVAAQVTAAIDANLI
AIICVGETEAERDANVTLNVVSSQLAGSIPTGATPAQIVVAYEPVWAIGTGRTPTLEQIA
EVHDHIRSELAARRGSAANDIPLLYGGSVKPGNAAEIFAVSNVDGALVGGASLKASDFGG
IIAALSAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaaactggcggcaggcaattggaagatgaacggggtagaggccgatttggcc
gaggtggacgctttgggcgaggctgttgcggcggccaattgcgacgtcttgctgtgcccg
cccgcgacgctgattgcgccgatggccaagcgcgcggggttgatggacctctatgtcggc
ggccagacatgccatacggccgcgtcgggcgcgcacactggcgacgtgtcggcggcgatg
ctggccgacgcgggcgcgagccacgtgatccttggccattcggaacgacgcgcagaccat
ggcgagcgcagcgaagatgtggcggcccaggtcacggccgccattgacgccaacctgatc
gcgatcatctgcgtcggcgaaaccgaagccgagcgtgatgcgaatgtgaccctgaacgtc
gtctccagccagttggcaggctccatccccaccggcgccacgcccgcgcagatcgtcgtg
gcctatgagcccgtctgggccatcggcacgggccgcacgccgacgctggaacagattgcc
gaggtccatgatcacatccggtctgaactggccgcgcgccggggcagcgccgccaatgat
atcccgctgctctatggcggatcggtcaagcccggcaatgccgcagagatctttgcggtg
tccaatgtggacggcgcgctggtcggtggcgcatcgttgaaggcgtcggatttcggcgga
attatcgccgccctgtccgccgcctga

DBGET integrated database retrieval system