KEGG   Jannaschia sp. CCS1: Jann_1845Help
Entry
Jann_1845         CDS       T00330                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00620  Pyruvate metabolism
jan00630  Glyoxylate and dicarboxylate metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Jann_1845
   00630 Glyoxylate and dicarboxylate metabolism
    Jann_1845
Enzymes [BR:jan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Jann_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABD54762
UniProt: Q28RA0
Position
1831612..1833750
Genome map
AA seq 712 aa AA seqDB search
MTSRVEKCGLQVAPELADFLEAQALPGSGVAAQTFWQGFSDLAHDLAPKNAALLARRDDL
QSQIDQWHIAHRDTAHDADAYHAFLSEIGYLVPEGEGFEIDTSNIDPEIATVAGPQLVVP
ITNARFALNAANARWGSLYDAFYGTDAMGSRPTKGGYDRGRGARVVARARVFLDEAFPIV
GTSHADVRRYHIEKGALLVDDKPLADPSQFAGYRGRAKAPDGVLLVNNGLHVELVFDRAH
TIGARDQAGLADVRMESAVSAIMDCEDSVACVDAEDKVLAYANWLGLMKGNLSETFEKGG
AQITRALAPDLQFTAPDGSDKIVKGRALTLVRNVGHLMTNPAVLLRDGAEIYEGLMDAMI
TTLIAMHDLVRDGGNSVAGSVYVVKPKMHGPDEVAFTNEIFTRVEAALGLPDYTVKIGIM
DEERRTSVNLKECIRAAKHRVAFINTGFLDRTGDEIHTSMEAGPFSRKDFIKRKGWITAY
ENQNVDIGLECGLRGRAQIGKGMWAKPDAMAEMLEQKIEHPRAGANCAWVPSPTAATLHA
LHYHKVNVADVQARLQAGGKRAYVTALLDIPLAAYRRWTREQVIREVENNAQGILGYVVR
WIDQGVGCSKVPDINGVELMEDRATCRISAQHIANWLHHNVLTEADVGEVFRRMAVVVDA
QNAGDPLYRPMAPGFNGIAYAAALDLVLKGRAQPSGYTEPVLHARRLEWKAG
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgggtcgagaaatgcggtttgcaggtggcaccagagttggccgatttcctt
gaggcgcaggcgctgcctggcagcggtgtcgcggcccagaccttctggcaaggcttctcg
gacctggcccacgatctggccccaaagaacgcggccctgttggcgcggcgcgatgacctg
caatcgcagatcgatcaatggcacattgcccaccgcgacactgcccatgacgcggatgcc
taccacgcgttcctcagcgagatcggttatcttgtgcccgagggggaggggttcgaaatc
gacacctccaacattgacccggaaattgccacggtcgcaggcccgcaattggtcgtgccc
atcaccaacgcgcgctttgccctgaacgcagccaatgcccgctggggcagcctctacgac
gccttctatggcaccgatgccatggggtcccgtcccaccaagggcggctatgaccggggg
cggggggcgcgtgtcgtggcccgcgcgcgggtgtttctggacgaggcgttcccgattgtc
ggcacctcccacgccgatgtgcgccgctaccacatcgaaaagggcgcgctgctggtggat
gacaagcccctggccgatccgtcgcaattcgcaggctaccggggccgcgcgaaagccccc
gatggggtgcttctggtcaataacggccttcatgtggagctggtctttgaccgcgcccac
accatcggcgcgcgggatcaggcggggctggcggacgttcggatggaaagtgcggtctct
gcgatcatggattgcgaggacagcgtcgcctgcgtcgatgccgaggataaggttctggcc
tatgccaactggctcggcctgatgaagggtaacttgtccgagacgttcgagaagggcggg
gcacaaatcacccgcgccctggccccggaccttcagttcaccgcgcccgatggcagcgac
aagatcgtgaagggccgcgcgctgacgctggtgcgcaatgtgggccacttgatgaccaac
cccgccgtgctcctgcgcgatggcgcggagatttatgaaggcctgatggacgcgatgatc
accacgctcatcgcgatgcatgatttggtgcgggatggcggcaattccgttgcgggctca
gtctacgtcgttaaacccaagatgcatggccccgacgaagtcgccttcaccaacgagatc
ttcacccgggtcgaggcggccctcggcctgccggactacacggtcaagattggtatcatg
gatgaggaacggcgcacgtcggtgaacctcaaggagtgtatccgggccgccaagcaccgg
gtcgcgttcatcaataccggctttctcgaccgcaccggtgacgagatccatacgtccatg
gaagccgggccgttctcccgcaaggacttcatcaagcgcaagggctggatcacggcctat
gaaaaccagaacgtcgatatcgggctggaatgcggcttgcgaggccgggcacagatcggc
aaggggatgtgggccaaaccggacgccatggccgagatgctggagcagaagattgaacat
ccccgcgcgggtgccaattgcgcctgggtgccatcgcccacggcggccacgctgcacgcg
ctgcattaccacaaggtgaacgtggccgatgtgcaggcgcgtctgcaagcggggggcaag
cgcgcctatgtcaccgcgctgctggatattccgctggccgcctatcgccgctggacccgg
gagcaggtgatccgcgaggtggaaaacaacgcgcaggggatcctgggctatgtcgtgcgg
tggatcgatcagggcgtgggatgctccaaagtgccggatatcaacggggtggagttgatg
gaggaccgcgcaacctgccggatctcggcgcaacatatcgccaactggctgcaccataac
gtcctgaccgaggcggatgtgggcgaggtcttccgccgcatggccgtggtggtggatgcg
caaaacgccggcgatccgctgtatcggcccatggcgccgggcttcaacgggatcgcctat
gcggcggcgttggaccttgttttgaagggccgggcgcagccatcgggttacaccgagccc
gttcttcacgcgcgccggttggagtggaaggcgggctaa

DBGET integrated database retrieval system