KEGG   Jannaschia sp. CCS1: Jann_2311Help
Entry
Jann_2311         CDS       T00330                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00072  Synthesis and degradation of ketone bodies
jan00650  Butanoate metabolism
jan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Jann_2311
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Jann_2311
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Jann_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase YjeF_N NAD_binding_7 2-Hacid_dh_C THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ABD55228
UniProt: Q28PY4
Position
2315961..2316746
Genome map
AA seq 261 aa AA seqDB search
MAITTDLSGKTAVITGSNSGIGLGVARELARAGANVVLNSYTDTKKDHALAEEIAANFSV
DARYIQADLSKGDQARGLIEEAGVCDILINNAGIQHVAPIDEFPVEKWDAIIAIMLSSAF
HTTAVALPMMRDAGWGRVINISSAHGLTASPYKSAYVSAKHGVVGMTKVVALETAKEPIT
ANAICPGYVLTPLVESQIPDTAKKYDMSEEEVKQKVILERQPSKEFATTEQLGGTVAFLC
SAAADQITGTTISVDGGWTAL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaccactgacttgtccggcaagaccgccgtgatcaccggatcgaactcggga
atcgggttgggggttgcgcgggaactggcccgcgccggcgcgaatgtcgttctgaattcc
tatactgacaccaagaaagaccatgcgttggccgaagagatcgccgccaacttcagcgtc
gatgcccgctatattcaggcggacctgtccaagggcgatcaggcccggggtctgatcgag
gaggcgggcgtctgcgatatcctgatcaacaatgcaggcatccagcacgtcgcccccata
gatgagtttccggtggagaaatgggatgcgatcattgcgatcatgctgtcctcggccttc
cacaccacggccgtggctctgccgatgatgcgcgacgccggctggggccgggtcatcaac
atctccagcgcccatggcttgaccgcgtcgccctacaaatcggcctatgtgtcggccaag
cacggcgttgtcggcatgaccaaggttgtcgcccttgagaccgcgaaagagcccatcacc
gccaatgccatctgcccaggctacgttctgaccccgctggtggagagccagatccccgac
acggcgaagaaatacgacatgtcggaggaggaggtgaagcagaaggtcatcctggagcgc
caaccctccaaggaattcgccacgaccgagcagttgggcggcaccgtcgccttcctctgc
tctgccgccgccgatcagatcactggcaccaccatcagcgttgacggaggatggacagcg
ttgtga

DBGET integrated database retrieval system