KEGG   Jannaschia sp. CCS1: Jann_2637Help
Entry
Jann_2637         CDS       T00330                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00430  Taurine and hypotaurine metabolism
jan00460  Cyanoamino acid metabolism
jan00480  Glutathione metabolism
jan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Jann_2637
   00460 Cyanoamino acid metabolism
    Jann_2637
   00480 Glutathione metabolism
    Jann_2637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:jan01002]
    Jann_2637
Enzymes [BR:jan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Jann_2637
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Jann_2637
Peptidases and inhibitors [BR:jan01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Jann_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABD55554
UniProt: Q28P08
Position
2651003..2652790
Genome map
AA seq 595 aa AA seqDB search
MRPTLPLILVVTLSAAPALAQQAADAVAPETETETAPYALSDRAAAAMAARDAGDPVMAQ
DWMVAAANPLAVEAGADVLAAGGTAADAMVAVQAVLGLVEPQSSGLGGGAFLVWYDAESG
ELTTLDGRETAPLAATPRLFQTEDREPMGFWDAVVGGLSVGTPGTPALMEDAHRRWGRAN
WGDLLDPAIALADDGFQVSPRMAGSIANDAERLSTFPATAAYFLPGGTPLAEGSTLMNPA
YAATLRAMQTQGADAIYEGAIAEGIIETVRSAEGNPGVLSMRDLDVYEVIERPAVCAAYL
DMDVCGMGPPSSGALTVGQILGISGTYDLTTPDDPNAWRIIGDSSRLAFADRGRYMADSD
YVPMPTEGLVDPAYLAERAALLEGDMALDEVAPGTPTWDHAQLWADDQSLEFPSTSHISI
VDSYGNVLSMTTTIENGFGSRLMTPGGFLLNNELTDFSFRTHADGVPIANRLEPGKRPRS
SMSPTIVMRDGEPILAIGSPGGSRIIGYVATTIIAHYEWGLDLQDAIALPHAVNRFGTYD
LEEGTDAEALAPALEAMGYEVNVRGLTSGLHAIAITPDGLVGGADPRREGIAIGE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccaccctccccctgatccttgtcgtgaccctcagtgcagcccccgcgcttgcg
caacaggccgcagatgccgtggctccggaaactgaaacggaaactgccccttacgccctg
tcggaccgtgccgccgctgccatggccgcacgcgatgcgggtgatcccgtgatggcacag
gactggatggtcgccgccgccaatccgctggccgttgaagccggcgccgatgtgctggcc
gcaggcggaaccgccgccgatgccatggtcgctgtgcaagccgtgctgggtctggtggag
ccgcaaagttctggcctgggcggtggcgcatttctcgtctggtatgatgcggaaagcgga
gagcttacaacgctcgacgggcgggaaaccgcgccgcttgccgccacgccgcgcctgttc
cagaccgaggatagggagccgatgggcttctgggacgccgtcgtgggcggcctgtccgtc
ggcacccctggcacgcccgcgctgatggaagacgcgcaccgccgctggggccgcgccaac
tggggtgatcttctggatccggccatcgcgctggccgatgacggcttccaggtctcgccg
cgcatggcaggctccatcgccaatgatgctgagcgtttgtccaccttccccgccactgcc
gcctatttcctgcccggcggcacgcctctggctgaaggctccacgttgatgaaccccgcc
tacgccgcgaccctgcgcgccatgcagacccaaggtgccgatgcgatctatgagggtgct
attgccgaaggcatcatcgagacggtccgcagcgccgagggcaatcccggcgtcctgtcg
atgcgcgatctggacgtctatgaggtgattgagcgtcccgccgtttgcgccgcatacctt
gatatggacgtctgtggcatggggccaccctcctccggcgcgctgaccgtggggcaaatc
ctgggcatatccggcacctacgacctgaccacgccagatgatcccaacgcctggcgcatc
attggcgactcctcccgcctcgcctttgcagaccggggccgatacatggccgatagcgac
tatgtcccgatgccgaccgaaggcctggtcgatccggcctacctggccgagcgtgccgcc
cttctggagggtgacatggcgctggacgaggtcgcccccggcacacccacctgggatcac
gcgcagctttgggccgatgaccaaagccttgaattcccaagcacatctcacatctccatc
gtcgacagctacgggaatgtcctgtcgatgacgacaaccattgagaatggcttcggctca
cgcctgatgacgccgggcgggttcctgctcaacaatgaactcaccgacttcagctttcgc
acccacgcagacggcgtgccgatcgccaaccggctggagcccggcaagcgtccgcgctcc
tccatgtcgcccaccatcgtgatgcgggacggcgaaccgatcctggctatcggctcgccg
ggcggcagccgcatcatcggttatgtggcgacgacgatcatcgcccattacgagtggggg
ctggacctgcaagacgccatcgctctgccccacgcggtgaaccgcttcggcacctatgac
cttgaggaaggcaccgacgccgaggccctggcccccgcgctggaagccatggggtacgag
gttaacgtgcgcggcctgacgtcgggcctccacgccatcgccatcacgccagatggcctt
gtcggtggcgccgatccgcgccgcgaaggcatcgcaatcggggagtaa

DBGET integrated database retrieval system