KEGG   Jannaschia sp. CCS1: Jann_3025Help
Entry
Jann_3025         CDS       T00330                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
jan  Jannaschia sp. CCS1
Brite
KEGG Orthology (KO) [BR:jan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:jan02044]
    Jann_3025
Secretion system [BR:jan02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Jann_3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA FliT RXLR_WY
Motif
Other DBs
NCBI-ProteinID: ABD55942
UniProt: Q28MX0
Position
3046392..3046895
Genome map
AA seq 167 aa AA seqDB search
MASIHDKLDKVRKPRVHIKYEVETEGAMVQKELPFVVGVLGDFSGDPTEDLKPFGDRKFV
QIDKDNFNEVMARMTPGLNFRVENTLSDEDDEMKVQLAFNSLDDFEPAQVVDQVPALKKL
LESRNQLRDLLSKADRSEELETLLEKMLQDDAALKDIVDQLKAEGEK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcattcatgacaaactggataaagtgcgcaaaccgcgtgtccacatcaagtat
gaggtcgagaccgaaggcgcgatggtccagaaggaacttcccttcgtggtgggcgtcctt
ggcgacttctccggcgatcccaccgaggatctgaaacccttcggtgaccgcaagttcgtg
cagatcgacaaggataatttcaatgaggtcatggcccgcatgacgccgggcctgaacttc
cgcgtcgagaacacgctgtcggacgaggatgatgaaatgaaggtccagctggccttcaac
tccctcgatgatttcgagcctgcgcaggtcgtggatcaggtgcccgcactgaagaagctt
ctggagagccgcaatcagttgcgcgacctgctcagcaaggccgaccgttcggaagagttg
gagacgctgctagagaaaatgttgcaggatgatgccgcgctgaaagacatagtcgaccag
ctcaaagccgaaggggagaagtga

DBGET integrated database retrieval system