KEGG   Jannaschia sp. CCS1: Jann_3026Help
Entry
Jann_3026         CDS       T00330                                 

Definition
(GenBank) protein of unknown function DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
jan  Jannaschia sp. CCS1
Brite
KEGG Orthology (KO) [BR:jan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:jan02044]
    Jann_3026
Secretion system [BR:jan02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Jann_3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ABD55943
UniProt: Q28MW9
Position
3046898..3048382
Genome map
AA seq 494 aa AA seqDB search
MATDAQTNPATQTTTEDQGTSLLSDVIGATRQTEPDRTKELIRTLTDAALDGTVSYNRNL
TITLTKAIEALDSRISEQLAAIMQAPEFAALEGSWRGLWHLVQNSNTSANLKIRVLNASK
KEIGRDLAKAVEFDQSRLFKAIYEDEFGTPGGEPMGALIGDFEFDNSFEDVECLQGISQV
SAAAFAPFISAASPRLFGFDDYTELSKPRDLSKTFDASEYAKWRSFRNSEESRFVTLTMP
RVLARVPYGPNTRTIDEFDYDEAIAYAGERIPHDNYCWMNASYALATNLTEAFNQTGWCT
AIRGAENGGKVEGLPMHLFSTDEGDVDIKCPTEIAITDRRDAELGAMGFLPLCYYKNHDY
AVFFGAQTAHKPAKYDKPEATANAAISARLPYMMATSRFAHYLKVIGRDKIGSFMEAEDC
EDWLNRWISNYVNANDAAGPDMRAQYPLRDAKVSVEEIPGKPGSYNAVAWLRPWLQMEEL
TTSLRMVARIPEKQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgacgcgcaaaccaatcccgccacgcagacaacgaccgaggatcagggcaca
tcgttgctgtccgatgtgatcggtgccacccgccagaccgagccggaccgcacgaaagag
ctgatccgcaccctcaccgatgccgccctcgacggcacggtcagctacaaccgcaatctg
acgatcacgctgaccaaggcgattgaggctctggacagccgcatttccgagcagttggcg
gcgatcatgcaggcccctgaatttgccgccctggaaggatcctggcgcgggctttggcat
ctggtgcagaactccaacacctccgccaatctgaagatccgggtgctcaacgcctccaag
aaagagatcgggcgcgacttggccaaggccgttgaattcgaccaatcccggctgttcaag
gcgatctatgaggacgagttcggcaccccgggcggggagcccatgggcgcgctgatcggc
gattttgagttcgacaacagctttgaagacgtcgaatgtctgcaaggcatcagccaggtg
tcggccgcagccttcgcgcctttcatctctgccgcctcgccaaggctcttcgggttcgac
gattacaccgaattgtccaaaccgcgcgatctgtccaagacttttgacgcgtcagaatat
gccaagtggcgcagcttccgcaattccgaggaaagccgcttcgtcaccctgacgatgccc
cgcgtactggcgcgcgtgccctacggccccaacacccgcaccatcgatgagttcgattac
gatgaggccatcgcctatgcgggcgagcgcatcccgcacgataattactgctggatgaac
gcctcctacgcgctggcgaccaatcttacggaagcgttcaaccagaccggttggtgcacc
gccattcgcggcgcggaaaacggcggcaaagtcgaagggctgccgatgcacctcttctcc
accgacgagggcgacgtagacatcaagtgccccacggagatcgccatcaccgaccggcgc
gatgcggagcttggggccatggggtttctgccgctttgctattacaagaaccacgactac
gccgtgttctttggcgcgcaaacggcccacaaaccggccaagtacgacaagccggaagcc
acggccaatgcggcgatttccgcccgcctgccctacatgatggccacgtcgcggttcgcc
cattacctcaaggtgatcggccgcgacaagatcggctcgttcatggaggcggaggattgc
gaagactggctgaaccgttggatcagcaactacgtcaatgccaatgacgcggcggggccg
gacatgcgggcgcaatatccgctacgcgatgccaaggtctcggtggaggagatccccgga
aagccgggcagctacaacgccgtggcctggctgaggccctggttgcagatggaagagctg
acgacgtccttgcggatggtggcccgtatccccgagaagcagtga

DBGET integrated database retrieval system