KEGG   Jannaschia sp. CCS1: Jann_3032
Entry
Jann_3032         CDS       T00330                                 

Definition
(GenBank) FHA domain containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
jan  Jannaschia sp. CCS1
Brite
KEGG Orthology (KO) [BR:jan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:jan02044]
    Jann_3032
Secretion system [BR:jan02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Jann_3032
SSDB
Motif
Pfam: Big_3_5
Other DBs
NCBI-ProteinID: ABD55949
UniProt: Q28MW3
Position
3053865..3055115
AA seq 416 aa
MSLVLELIDSGERRIVQEARAFTLGSFPGATWSLPQSPGAVPAGEVRILPDGASATVTLL
RGAASLDQRALADDPRPLPSDAVLQIGSHRVRAQYRTDLITSHATEAPTISAILADVTPG
GITAASPVPARSEDDWIAELTGDGPGTRPDWDNLGRYTGRDTAQAAEPNPLDTLPSGNAF
LPDDWDDAGTDTQNRMAQSVLPGHVMAARDSVTSEAAPNSIAPDALTLAFLKGAEILPEE
VTPLGPAQMQALGALLLQALDGIAALEAARARRAADLGLPRPPLTRDAFATLFAALQSGP
DAARDLAARLADLALDGDAVLRGAQAFAADARDALDPAVIEAAAADGGVMTRLAGGRSRA
AWATYRARVTGQGGTEDGGDPPPPLSEAALLSAIAARYGKTSTEAIDDTDESGGTG
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgagcctagtgctggaattgatcgacagcggcgaacgccggatcgtgcaagaggcgcgc
gcctttaccctcggcagttttccgggggccacttggtcgctgccgcaatctcccggcgcg
gtccccgccggggaggtgcgcattctgcccgatggggcgtccgccaccgtgacgttgttg
cgcggtgcggccagcctagatcagcgcgccttggccgatgacccgcgccccctgccctct
gacgccgtcctgcaaatcgggtcgcaccgtgtgcgggcacaatatcgcactgatctgatc
acctcccatgcgaccgaggccccgacaatcagcgcgatcctcgccgatgtgacacccggg
gggatcacggcggccagtcccgtgcccgcccgatccgaggatgactggatcgcagagctg
accggcgatggccccggcacgcgtcccgattgggataatcttggccggtatacgggtcgg
gacaccgctcaggcagcagagccaaacccgctggacaccctgccgtcgggcaacgccttc
ctccccgacgactgggatgacgcgggcaccgatacccagaaccgcatggcccaatcggtc
ctgcccggtcatgtcatggccgcaagggacagcgtcacgtcagaggccgcgcccaacagc
attgcgccggacgcgctgaccctcgcgtttctcaaaggggctgagatcctgcccgaagaa
gttacccccctcggtcccgctcagatgcaagccctgggtgcactcttgctgcaggcgctt
gacgggatcgccgcgctggaagccgcccgagcgcggcgcgccgccgatctgggcctgcca
cgcccccccctgacccgcgacgccttcgccacgctcttcgcggccttgcaatcggggccg
gacgcggcccgtgatctggccgcccggctggcggatttggccttggatggcgacgcggtg
ctgcgtggtgcgcaggccttcgccgccgacgcccgggacgcgctggaccccgcggtgatt
gaggcggccgccgctgatggaggcgtaatgacgcgcttggccgggggccgcagccgcgcc
gcctgggccacctatcgcgcccgggtcaccggccagggcggaacggaggacggcggcgat
ccgccaccccccctgtccgaggccgcgctgctgtccgcaatcgcggcgcgctacggaaag
accagcacagaagccattgatgacactgatgaatcggggggaaccgggtga

DBGET integrated database retrieval system