KEGG   Jannaschia sp. CCS1: Jann_3113Help
Entry
Jann_3113         CDS       T00330                                 

Definition
(GenBank) 14-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00500  Starch and sucrose metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Jann_3113
Enzymes [BR:jan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Jann_3113
Exosome [BR:jan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Jann_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABD56030
UniProt: Q28MN2
Position
3147769..3149685
Genome map
AA seq 638 aa AA seqDB search
MAQKTSTPPPDTIQAGDMITDFDQYLLGEGTHRQLWRVLGAHVQDDATHFAVWAPNARAV
SVTGDFNGWSGTEMTAVGQTGVWQVRIPGVGDGALYKYQITDANGALREKADPVGFGAQH
PPEQASVVRDIRGYGWRDGAWMETRAEAADRAAPISIYEVHLGSWRRKWDDGGRPLSYKE
AAQDLVGYVRHMGFTHIELMPISEFPFDGSWGYQPVGLYAPTIRFGPPHEFRDLVDAAHA
AGLGVLLDWVPGHFPTDEHGLATFDGTHLYEHADPKEGFHQDWNTLIFNYGRTEVRNYLV
ANALYWMEEYHLDGLRVDAVASMLYRDYSRDEGQWVPNKDGGRENLEAISFLQEMNVAVY
GADASVMTVAEESTSFPGVSQPVHTGGLGFGYKWNMGWMNDTLSYMALDPIHRQHHHSQM
TNPIMWQYSENFILPISHDEVVHGKGSMLEKMPGNDWEKLANLRAYYGYMWMHPGKKLIF
MGCEFAQPGEWSHDGDLNWDAASRPAHAGVQALVRDLNHLYRDTPALHVKDCMPDGFAWI
CNDPAQSTLGFARFGAAGDAPVVVMCNFTPVERVAFRMGVPTPGEWDEVLNTDAAAYGGG
NRGNLGGVLSEPTPCDGHAQSVTLTLPPLSTVVLRLKD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtggcacagaagacatccacacctccgcctgacacaatccaagcgggcgatatgatcacc
gactttgaccaataccttttgggcgaagggacgcaccgccagctgtggcgggttctgggt
gcacatgtgcaagacgatgcgacgcattttgccgtctgggcgcccaacgcccgggccgta
tctgtcactggtgatttcaacggctggtcgggcaccgagatgaccgccgtcggacagacc
ggcgtctggcaggtgcgcattccgggcgtaggcgacggcgcactctacaaataccagatc
actgacgccaatggcgcgctgcgcgagaaggcggaccccgtgggcttcggcgcgcagcac
ccgccggagcaagcctccgtcgtgcgcgatattcgcggctatggctggcgcgacggcgct
tggatggaaacccgtgctgaggcggctgaccgcgcggccccaatctccatctacgaggtg
catctggggtcctggcggcgcaaatgggacgatggcggcaggcccctgtcctacaaggag
gccgcgcaggatctggtgggctacgtgcgccacatgggcttcacccatatcgagttgatg
ccgatatcggagtttcccttcgacgggtcctggggctaccagcccgtgggcctttatgcc
cccacgatccgcttcggcccgccgcatgaattccgcgatctggtggatgccgcccacgcc
gccggtcttggcgtcctgctggattgggtgccgggccatttcccgaccgacgagcatggg
ttggcgacctttgacggcacgcatctctatgaacacgccgacccgaaagagggcttccat
caggattggaacactctgatcttcaactacggccgcacggaggtgcgcaattacctcgtc
gccaatgcgctgtactggatggaggaatatcacctcgacgggctgcgcgtggatgccgtg
gcctccatgctctaccgcgattattcccgcgatgaggggcagtgggtccccaacaaagac
ggcgggcgcgagaaccttgaggcgatttccttcctgcaggagatgaacgtcgcggtctac
ggcgcggatgccagcgtcatgacggtggccgaagaaagcacgtcctttcctggcgtctcg
cagcccgttcataccggcggtctggggttcggatacaagtggaacatgggctggatgaac
gacacgctcagctacatggcgcttgatccgatccaccgccagcaccaccattcccagatg
accaacccgatcatgtggcagtactccgaaaactttatcctgccgatcagccatgatgag
gtcgtccatggcaaaggctccatgctggaaaaaatgcccggcaatgattgggagaaactt
gccaacctgcgggcgtattacggctacatgtggatgcaccccggcaagaagctgatcttc
atgggatgcgagttcgcgcaacccggggaatggtcccatgacggcgatctgaattgggac
gcggccagccgaccggcccatgcgggcgtgcaagcattggtgcgtgacctcaaccatctc
tatcgcgacacgcctgcgctgcacgtcaaggattgtatgccagacggtttcgcctggatc
tgcaacgaccctgcgcaatccaccctcgggttcgcgcgcttcggggccgcgggtgacgcg
cccgtggtggtcatgtgcaactttacaccggtggagcgcgttgcattccgaatgggcgtg
cccacgccgggagagtgggacgaagttctcaacaccgacgcagccgcctatggcggcggc
aatcgcggcaatctgggtggggttctgtctgagccgacgccctgcgatgggcatgcgcag
tccgtcacgctgaccctgccgcccttatcgacagtcgttttgcggctgaaagactaa

DBGET integrated database retrieval system