KEGG   Jannaschia sp. CCS1: Jann_3864Help
Entry
Jann_3864         CDS       T00330                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
jan  Jannaschia sp. CCS1
Pathway
jan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jan00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Jann_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABD56781
UniProt: Q28KI1
Position
complement(3962686..3963198)
Genome map
AA seq 170 aa AA seqDB search
MFDTMTITKVGGAVCAALLVFLLGGWAAEELYAIDNHSEDHVSGYRIALPDDDSPAAEPE
PEIPFEEVYAVADAGAGERLWRQCSACHALNAGQNGVGPYLAGIVDRPKHSADGFDYSDA
LLALEGAWTPENISSFITNPRAYAPGTSMSYGGMDDVEDRANLIAYLATQ
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacgatgacgattacgaaagtaggcggtgcagtctgcgcagcccttctggtg
ttcctcttgggcggctgggccgctgaggagttgtacgccattgataaccacagcgaagat
cacgtcagcggctaccgcattgccttgcccgatgacgattcgccggcggcagagcccgag
cctgagattccgttcgaggaggtctatgccgtcgccgatgcaggggctggagagcgcctg
tggcgtcagtgttccgcctgtcacgcgctgaacgcgggccagaacggtgtgggtccctat
ctggctgggatcgtggaccgcccgaagcattcggctgatgggtttgactactcggatgcc
ctgttggctcttgaaggggcgtggacgcctgagaatatctcgtcgttcattaccaacccc
cgcgcctatgcgccgggaacctcgatgagctacggtggcatggacgacgtggaagaccgc
gccaacctgatcgcgtatctcgcgacgcagtag

DBGET integrated database retrieval system