KEGG   Jannaschia sp. CCS1: Jann_3883Help
Entry
Jann_3883         CDS       T00330                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:jan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Jann_3883
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     Jann_3883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ABD56800
UniProt: Q28KG2
Position
complement(3980597..3981406)
Genome map
AA seq 269 aa AA seqDB search
MGLSIQGKTAIVTGAANGVGLAIARHFIDCGANVMFADRDKTRLKDECGETEGDDEKIRY
FSGDLRERLTVENLVSATIDAYDRVDILVNASRQVQTTDPLDAADTSVEGMLNQNLFPSL
RLTQSVAKRMIAQAEDDGHVDGPIGSIVNISSIAARRTHPDLMGYSIATAALDQATRSLA
VALAGNRIRVNGVAFGSVMSASLKDSLNETDGLREEIRECTPMGRIASAKEVTAAVQFLA
SDASGFVTGEVITVDGGRTLLDAVTTAAH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcctttccatccaaggcaaaaccgccatcgtcaccggcgccgccaacggcgtgggc
ctggcgattgcgcgccatttcatcgactgcggcgcgaatgtcatgttcgctgatcgcgac
aagacccgcctgaaagacgaatgcggcgagaccgagggcgatgacgagaagatccgctac
ttctcgggcgatctgcgcgagcgtctgacggttgagaacctcgtatccgcaaccatcgac
gcctatgatcgtgtggatattctggtgaacgcgtcgcgtcaggtgcagacgactgatccg
ctggatgctgccgacacatcggttgagggcatgctgaaccagaacctgttcccatccctg
cgcctgacccagtccgtggccaagcgcatgattgcccaggccgaagacgacgggcatgtg
gatgggccgattgggtcaatcgtcaacatctcctccattgccgctcgccgcacgcatccg
gacctgatgggctattctatcgcgacggcagccctggatcaggccactcgcagtcttgcc
gtggcgctggcgggcaatcgcatccgcgtcaatggcgtggcgttcgggtccgttatgtcc
gcgagcctgaaggattcgttgaacgagaccgatggcctgcgcgaagaaatccgtgaatgc
acgcccatgggccgcatcgcatccgcgaaagaggtgacggcggcagtgcagttccttgcg
tctgatgcgtcaggcttcgtgaccggagaggtcatcaccgtcgatggcgggcgcacgctt
ttggatgccgttacgacggcagcgcactga

DBGET integrated database retrieval system