KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_15370Help
Entry
YQ44_15370        CDS       T04539                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YQ44_15370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:jaz03400]
    YQ44_15370
Enzymes [BR:jaz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YQ44_15370
DNA repair and recombination proteins [BR:jaz03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     YQ44_15370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD SH3_13 AAA_11 AAA_22 UvrD-helicase AAA_25 PhoH DUF2075 PIF1 AAA_28
Motif
Other DBs
NCBI-ProteinID: APA68951
UniProt: A0A1I9XYV9
Position
complement(3555218..3557185)
Genome map
AA seq 655 aa AA seqDB search
MKHDAALDALFTHFDGVAEAGHLRRLSAAFARFIVTLDEDAPAGPDTAAVGVACVVLSEL
EGRGHSCLMLADLAGEPSQLLGWSEELWHAVLAVSGPLPGTVDGWCALLAAAPQVWQVGA
ADVRQPLVLDGARLYLRRYWRDETLVGGKIAARAQDLANPPLAQVRQWLDILFDQPTSDG
APDWQKVACAIALRGKVAIITGGPGTGKTYTVASLLTLLFAVSPQPEQLRIALAAPTGKA
AARLKQSIDKALEGLAAKAGAALPLLELARRMGAARTLHSLLGARPDTRAFAHHAGNPLD
VDVLIVDEASMVHLEMMASMLDALPPTAILILLGDKDQLASVEAGAVLGDLCHDAQAGGY
APDTIAYALAASGVAIPAGFAGAAGALAQQTVMLRHSHRFSGPIGELALAVNAGQPRAAQ
ECLARDSGGKVAWIVPAQQEDVLRLALRGRPEAPGGYQPYLELVHAGVAAHARHDDWVRA
VLHAFESFRILCAVREGEWGVAGLNAAIELCLEKEGWIRRSEWYVGRPVMVTRNDYGTGV
FNGDIGLTLRDPARPGSLRVYFLEGDNVRSVLATRLRHVETAFAMTVHKSQGSEFRHTVL
VLPQEGGAMLARELVYTGITRARDFFTLVSPTQAVLFDAILRRTQRASGLRALIG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgacgcggccctggacgccttgttcacccatttcgacggcgtcgccgaggcg
ggccacctgcgccgcctgagcgccgcctttgcccgtttcatcgtcaccctggacgaagat
gcgcccgccggacccgatacggccgccgtgggcgtggcgtgcgtggtgctgtccgagctg
gaagggcggggccacagctgtttgatgctggccgacctggccggcgaaccgtcgcagctg
ctgggctggagcgaggagctgtggcacgccgtgctggccgtatcgggcccgctgccgggc
actgtcgatggctggtgcgcgctgctggccgctgcgccgcaggtgtggcaggtgggcgcc
gccgatgtgcgccagccgctggtgctcgatggcgcgcgcctgtatttgcgccgctactgg
cgcgacgagaccctggtgggcgggaaaatcgccgcgcgcgcgcaggatttggcgaatccg
ccgctggcgcaggtgcggcaatggctcgatatcctgttcgaccagcccaccagcgatggc
gctccggactggcagaaggtggcgtgcgccatcgccctgcgcggcaaggtggccatcatc
acgggcggcccgggcacgggcaagacgtacaccgtggcgagccttctgaccttgctgttt
gccgtctcgccgcagccggaacagctgcgcatcgcgctggccgcgcccacgggcaaggcg
gccgcgcgcctgaaacagtcgatcgacaaggccctggagggcctggcggcgaaggcgggc
gcggcgctgcccttgctggagctggcgcggcgcatgggcgccgcgcgcaccctgcatagc
ttgttgggcgcgcgtccggatacgcgcgccttcgcccaccacgcgggcaatccgctcgac
gtcgacgtgctgatcgtcgatgaagcgtcgatggtgcacctggagatgatggcgtccatg
ctcgacgccttgccgcccacggccattttgatcctgctcggcgacaaggaccagctagcg
tccgtggaggcgggcgccgtgctgggcgacttgtgccacgacgcgcaggcgggcggctat
gcgcccgacaccatcgcgtacgcgctggcggccagcggcgtggccatacccgccggtttt
gcgggggcggccggcgcgctggcgcagcagacggtgatgctgcgccacagccaccgcttc
agcggcccgatcggcgaactggcgctggccgtgaatgcgggccagccccgcgccgcgcaa
gagtgcctggcgcgcgacagcggcggcaaggtggcgtggatcgtgcccgcgcagcaggaa
gacgtgctgcgcctggccctgcgcggacgtcctgaggcgccgggcggctatcagccctat
ctggaattggtgcatgccggcgtagcagcgcatgcgcgacatgacgactgggtgcgcgcc
gtgctgcacgcgttcgagtcgttccgcatcctgtgcgccgtgcgcgaaggcgagtggggc
gtggcgggcctgaacgcggccatcgagctgtgcctggaaaaggaaggctggatccgccgc
agcgagtggtatgtgggccgtcccgtgatggtcacgcgcaacgactacggcacgggcgtg
ttcaatggcgacatcggcctgaccctgcgcgacccggcgcggcccggttccctgcgcgtg
tacttcttggaaggcgacaacgtgcgcagcgtgctggccacgcgcttgcgccatgtggaa
acggcgttcgccatgacggtgcacaagtcgcagggctcggaatttcgccacacggtgctg
gtgctgccgcaggaaggcggcgccatgctggcgcgcgagctggtttacacgggcatcacg
cgcgcgcgcgatttctttaccctcgtctcgcccacgcaagccgtgctgtttgacgcgatc
ttgcgccgcacgcagcgcgccagcgggctgcgcgcattgataggctga

DBGET integrated database retrieval system