KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_23695Help
Entry
YQ44_23695        CDS       T04539                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    YQ44_23695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APA71659
UniProt: A0A1I9Y6L7
Position
complement(5466765..5467139)
Genome map
AA seq 124 aa AA seqDB search
MATYEFTVTVKTQYLPEQSAPEQGRHVFSYTIRVVNTGTVGAQLISRHWVITDANDKVEE
VRGLGAVGHQPLLQPGEQFEYTSGTMLATPQGSMRGEYFCVAEDGHQFVAAIPEFVLSLP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttatgaatttacggtaacggtcaagacgcagtacctgcctgagcaatcggcg
cccgagcagggccgccatgtgttcagctacacgattcgcgtcgtcaacacggggaccgtc
ggcgcgcaactgatttcgcgccactgggtcatcacggatgcgaatgacaaggtggaggaa
gtgcgcggcctgggcgccgtcggccaccagccgctgctgcagccgggcgagcagttcgaa
tacacgagcggcaccatgctggccacgccgcaaggctcgatgcgcggcgagtacttctgc
gtggccgaagacgggcaccagttcgtggcggccatcccggaattcgtgctgtcgctgccg
cgcaccctgcattaa

DBGET integrated database retrieval system