KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_25865Help
Entry
YQ44_25865        CDS       T04539                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00040  Pentose and glucuronate interconversions
jaz00053  Ascorbate and aldarate metabolism
jaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YQ44_25865
   00053 Ascorbate and aldarate metabolism
    YQ44_25865
Enzymes [BR:jaz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     YQ44_25865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APA70666
UniProt: A0A1I9Y3S4
Position
complement(5956333..5957910)
Genome map
AA seq 525 aa AA seqDB search
MSFNITGEALIGGVAVKGNGGSFEAWDPAARAHIAPAFHMVDVAQIDEACRLAQAAFDPF
RATSDAERADFLDTIAAQIVELGDELIVRAMTESGLPRARLEGERGRTVGQLKLFAGLLR
EGSWTDARIDSPLPERVPPRPDLRLRMIGLGPVAVFAASNFPLAFSVAGGDTASALAAGC
PVVLKAHSAHPGTSELVARAIVKAIALCKLPAGVFALLTGTGNGIGQTLVAHPAIQAVGF
TGSRSGGIALMKVAAERPQPIPVYAEMSSINPVFVLPQALAARGAAIASGFAASLTMGVG
QFCTNPGLVLGLEGADFTAFAAAAAEALAPAPAATMLTAGIASSYAKGVAALAQHADVTP
LVQNAGEEGKGAAALFVTSGAAFLAKHDLRDEVFGPASLLVACRDIEQLLAITESLEGQL
TATLQMDQGDVADARRLLPVLERRVGRILANGFPTGVEVSTAIVHGGPFPATSDGRSTSV
GTAAINRFLRPVSYQNLAQDLLPESLRDDNPLGIWRRKDGVLGKD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaacatcaccggtgaagcactgatcggcggcgttgccgtcaagggcaatggc
ggctccttcgaagcgtgggatccggccgcgcgcgcgcacatcgcgcctgccttccacatg
gttgacgtagcgcaaatcgacgaggcgtgccgcctggcgcaagccgcgtttgacccgttc
cgcgccaccagcgatgcggaacgcgccgatttcctcgacaccatcgccgcgcaaatcgtc
gaactgggcgacgagctgatcgtgcgcgccatgacggaaagcggcttgccgcgcgcgcgc
ctggaaggcgaacgcggccgcacggtcggtcagttaaaactgttcgccggcttgctgcgc
gaaggttcatggaccgatgcgcgcatcgacagcccgctgccggagcgcgtgccgccacgc
cccgacttgcgcttgcgcatgatcggcctgggtcccgtcgccgtgtttgcggccagtaac
tttccgctggccttctccgtcgccggcggcgatacggcctcggccctggcggccggctgt
cccgtcgtgctgaaggcccactcggcccatcccggcacctcggaactggtggcgcgcgcc
atcgtgaaagcgattgccctgtgcaagctgccggccggcgtcttcgccctgttgacgggc
acgggcaatggcatcggccagaccctggtggcccatcctgccatccaggccgtgggcttc
acggggtcgcgttcgggcggcatcgccctgatgaaggtggcggccgagcgtccgcagcct
atccccgtgtatgcggaaatgagcagcatcaaccccgtgtttgtgctgccgcaagccctg
gccgcccgtggcgccgcgatcgccagcggctttgccgcctcgctgacgatgggcgtgggc
cagttctgcacgaatcccggcctcgtgctgggcctggaaggggccgacttcacggccttc
gccgccgccgccgccgaagcgctggcaccggcgccggccgccaccatgctgacggccggc
atcgccagcagctatgccaagggcgtggctgccctggcgcagcacgccgacgtgacgccg
ctggtgcagaatgcgggagaagagggcaagggcgccgccgccctgttcgttacatcgggc
gcggccttcctggccaagcacgatctgcgcgatgaagtgttcggccccgcgtcgctgctg
gtggcttgccgcgacatcgagcaactgctggcgatcacggaaagcctggaaggccagctg
acggccaccctgcagatggaccagggcgacgtggcagacgcgcgccgcctgctgcccgtg
ctggagcgccgcgtgggacgcatcctggccaacggtttccccaccggcgtggaagtgtcg
acggccatagtgcacggcggcccgttcccggccacgtcggacggccgcagcacgtccgtg
ggcacggcggccatcaaccgcttcctgcgtcccgtgtcgtaccagaacctggcgcaggac
ttgctgccggagtcgctgcgcgacgataatccgctgggcatctggcgccgcaaggatggc
gtgctgggcaaggactaa

DBGET integrated database retrieval system