KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_27245Help
Entry
YQ44_27245        CDS       T04539                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00071  Fatty acid degradation
jaz00072  Synthesis and degradation of ketone bodies
jaz00280  Valine, leucine and isoleucine degradation
jaz00310  Lysine degradation
jaz00362  Benzoate degradation
jaz00380  Tryptophan metabolism
jaz00620  Pyruvate metabolism
jaz00630  Glyoxylate and dicarboxylate metabolism
jaz00640  Propanoate metabolism
jaz00650  Butanoate metabolism
jaz00900  Terpenoid backbone biosynthesis
jaz01100  Metabolic pathways
jaz01110  Biosynthesis of secondary metabolites
jaz01120  Microbial metabolism in diverse environments
jaz01130  Biosynthesis of antibiotics
jaz01200  Carbon metabolism
jaz01212  Fatty acid metabolism
jaz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YQ44_27245
   00630 Glyoxylate and dicarboxylate metabolism
    YQ44_27245
   00640 Propanoate metabolism
    YQ44_27245
   00650 Butanoate metabolism
    YQ44_27245
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YQ44_27245
   00072 Synthesis and degradation of ketone bodies
    YQ44_27245
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YQ44_27245
   00310 Lysine degradation
    YQ44_27245
   00380 Tryptophan metabolism
    YQ44_27245
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YQ44_27245
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YQ44_27245
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YQ44_27245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jaz04147]
    YQ44_27245
Enzymes [BR:jaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YQ44_27245
Exosome [BR:jaz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YQ44_27245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APA70902
UniProt: A0A1I9Y4G0
Position
complement(6262606..6263802)
Genome map
AA seq 398 aa AA seqDB search
MNDPVVIVGAARTPMGAFQGDFANVTASDLGAVAIRAAVERAGIAPDAVEHVYFGNCLMA
GQGQAPARQALRKAGLPDSTGAVTLSKMCGSAMQTTMFAHDTLLAGSADVVVAGGMESMT
NAPYLVPKARGGYRIGHGMIYDHMMMDGLEDAYSRDEKGNARSMGTFAEECASQYSFTRE
AQDAFAIESVKRAQAATKDGSFAWEIVPVTVSGRGGDTVVSIDEGPQKARLEKIPTLKAA
FKKDGTITAASSSSINDGAAALVLMRESTAKKLGCTIIAKIHGHATHAQAPNEFTTAPIG
AVKKLYAKTGWSSSNVDLFEINEAFAAVPMAAMHDLDIPHSKINIHGGACALGHPIGASG
ARIIVTLLGALKKTGGKRGVAALCIGGGEATAMAIELV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacccagtcgtaatcgtcggtgccgcgcgcactcccatgggcgccttccagggc
gactttgccaacgttaccgccagcgacctgggcgccgtcgccatccgcgccgccgtcgag
cgcgccggcatcgcgccggacgccgtcgaacacgtgtatttcggcaattgcctgatggcc
ggccagggccaggcgcccgcgcgccaggccttgcgcaaggccggcttgccggactccacc
ggcgccgtgaccctgtccaagatgtgcggctcggccatgcagacgaccatgttcgcgcac
gacaccttgctcgccggcagcgccgacgtggtggtggcgggcggcatggaatcgatgacc
aacgccccctacctggtgccgaaggcgcgcggcggctaccgcatcggccacggcatgatc
tacgaccacatgatgatggatggcctggaagacgcctacagtcgcgatgaaaagggcaat
gcccgctcgatgggcacgtttgcagaggagtgcgccagccaatacagcttcacgcgcgaa
gcgcaggacgcgtttgccatcgaatccgtgaaacgcgcgcaggcggccaccaaggatggc
agcttcgcatgggaaatcgtgcccgtcaccgtctccggccgcggcggcgacaccgtcgtc
agcatcgatgaaggcccgcaaaaggcgcgcctggaaaaaatcccgaccttgaaggccgcc
ttcaagaaagacggcaccatcacggccgcctcgtcctcgtcgatcaacgacggcgccgcg
gccctggtgctgatgcgcgaatcgacggcgaaaaaactcggctgcaccatcatcgccaag
atccacggccacgccacgcatgcgcaagcgcccaacgagttcaccaccgcccccatcggc
gccgtgaaaaaactgtatgcaaaaacgggctggagcagcagcaatgtcgatctgttcgag
atcaatgaagcattcgccgccgtgccgatggcagccatgcacgacctcgacattccacac
agcaagatcaacatccacggcggcgcctgcgccctgggccacccgatcggcgcctcgggc
gcgcgcatcatcgtcaccctgctgggcgccttgaaaaaaactggcggcaagcgcggcgtg
gccgccctgtgcatcggcggcggcgaagcgacggcgatggcgatcgaactggtataa

DBGET integrated database retrieval system