KEGG   Jatropha curcas: 105628649Help
Entry
105628649         CDS       T03922                                 

Definition
(RefSeq) beta-glucosidase 13 isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
jcu  Jatropha curcas
Pathway
jcu00460  Cyanoamino acid metabolism
jcu00500  Starch and sucrose metabolism
jcu00940  Phenylpropanoid biosynthesis
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105628649
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    105628649
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    105628649
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     105628649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 105628649
NCBI-ProteinID: XP_012065488
UniProt: A0A067LGV0
Position
Unknown
AA seq 518 aa AA seqDB search
MKITGSLFIFLISLVSSVVCSEDSTESLAYGHHHRNSFPAGFIFGTASSAYQIEGAANED
GRGPSIWDTFSQKYPEKIKDHSNGNIAVDSYHRYKEDVAIMKSLGFDAYRFSISWSRLLP
RGHLNGGVNQAGINYYNNLINELLLNGIQPFVTLYHWDLPQALEDEYGGFLSAKIIKDFH
DYAELCFSKFGDRVKHWITLNEPLVSADDGHARGIKAPGRCSKWLSRNCTGGDSSTEPYI
VGHYQLLAHAAAVKVYRDKYQMSQMGQIGITLNCAWIVPMTESSQDSSAASRGIAFQYDW
FMEPLKSGSYPVDMVTHVGKRLPQFSAEQSLMVKGSFDFIGLNYYTSKYATDVPCKSENL
SFSTDSCVKITTERNGIPIGPKTASDWLYVYPRGIQELLLYTKYKFNNPAIYITENGVSE
LDTGSLLLDDDIRVDYYNAHFSFIKKAIMNGVNVKGFFAWSLVDNFEWDDGYKIRFGIIY
IDYTDRLKRHPKKSALWFKEFLHFGNQTRLKRQDLAVY
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaagattacaggctctctattcatatttctcatttctctggtttcatcagtggtctgc
agtgaagattctacggagagtttggcttatggtcaccatcaccggaacagttttccggct
ggatttatatttgggactgcatcatctgcttaccagattgaaggtgcagcaaatgaagat
ggtagaggaccaagtatatgggacaccttcagccaaaaatatcctgagaagataaaggac
cacagtaatggaaacattgccgtcgattcatatcataggtacaaggaagatgtggctata
atgaagtccctgggttttgatgcttacagattttccatttcatggtctagactattacct
cgtggtcaccttaatggaggagtaaatcaagcaggcattaattactacaataatctgatc
aacgaactcctattgaatggaatccaaccttttgtgactttataccactgggatcttcca
caagcccttgaagatgaatatggtggttttttaagtgccaaaatcatcaaagattttcat
gactatgcggagttatgcttcagcaagtttggtgatagagtaaagcactggattaccttg
aatgagccacttgtctctgcagatgatgggcatgcacgtggcataaaagcaccaggcagg
tgttcaaagtggttatctcgaaactgcactggtggtgattcaagtactgaaccatatata
gtaggccattaccaacttcttgctcatgctgctgcagttaaagtttacagggacaaatat
cagatgtctcaaatgggtcaaattggaattactttaaactgtgcctggattgtacccatg
actgagtcaagtcaagactctagtgcagcatctcgaggcatcgctttccagtatgattgg
tttatggaaccactgaagtctggctcgtatccagttgatatggtaactcatgtgggaaaa
agattacctcaattttctgcagagcaatccttgatggttaaaggatcttttgatttcatt
ggcctaaattattatacttcaaaatatgcaactgatgttccttgcaaaagtgaaaactta
agcttttccacggactcttgtgttaagattacaactgagcgaaatgggattcctattggt
ccaaagacggcatcagattggctttatgtttatcctagaggaatccaagaacttttgctc
tacaccaagtacaagtttaacaatccagccatttatataactgaaaatggagttagtgag
cttgacactggttctttattgcttgatgatgacataagagttgattactataatgctcat
ttttcattcataaaaaaggcaatcatgaatggtgtcaatgtgaagggattttttgcatgg
tcactggtagacaattttgaatgggatgatggttacaaaattcgttttggaatcatctac
atagactatacagacagattgaagaggcacccgaaaaaatcagccttgtggttcaaggaa
tttcttcatttcgggaatcagactcgactaaagagacaagatcttgcagtttattaa

DBGET integrated database retrieval system