KEGG   Jatropha curcas: 105629125Help
Entry
105629125         CDS       T03922                                 

Definition
(RefSeq) serine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
jcu  Jatropha curcas
Pathway
jcu00340  Histidine metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    105629125
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     105629125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 105629125
NCBI-ProteinID: XP_012066036
UniProt: A0A067L6X9
Position
Unknown
AA seq 484 aa AA seqDB search
MPMEVEAAPVPVHINGEKAEILAEDFDLRAVIKEPLPPVVTAEEEVAGEEETKQNGREIV
LGRNLHTECLEVTEPDANDEHTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGA
LGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDQYWGYITNCGTEGNL
HGILVGREVLPDGILYASRESHYSVFKAARMYRMGCVKIDCLVSGEIDCADFKVKLLANK
DKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTHDRFYIHCDGALFGLMMPFVKRAPKV
SFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINVLSRNVEYLASRDATIMGSRNGHAPI
FLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPRDEEFVR
RWQLACQGSIAHVVVMPNVTIEKLDNFLNELIEKRSTWYQDGQLQSPCIATDVGSENCAC
ALHK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggaagtcgaagcggcgcctgttcctgtccacattaacggagaaaaggcggag
atcttggcggaggacttcgatctgagggctgtgattaaagagcctttgccaccggttgtg
acggcggaggaagaggtggctggtgaagaggagacgaaacaaaatgggagagagattgtg
ttagggagaaacttgcacactgagtgtcttgaggtcacagaaccagatgctaacgatgag
cacactggagataaagaagcttatatggctagcgttttggctaggtatagaaagaccttg
atggaaaggacaaagcatcatttaggttatccttataatttggatttcgactacggtgct
ttaggacagttgcagcatttctccataaacaatcttggtgatccatttattgaaagtaac
tatggtgtccattcaagacaatttgaagttggtgttttagattggtttgcccgtctgtgg
gagatagagaaagatcaatactggggttacataaccaactgtggtacagaaggaaatctt
catgggattctagtagggagggaagtgcttccagatggaattctgtatgcatcacgagaa
tcacattattctgtcttcaaagcagctcgtatgtatagaatgggatgtgtgaagattgac
tgtctggtttctggtgaaatcgattgtgctgattttaaagttaaactactcgctaacaag
gacaaaccagctatcatcaacgttaatataggcacaactgtcaaaggagcagttgatgac
cttgatcttgtaatacaaacgcttgaagaaagtggatttacgcatgatcggttctacatc
cactgtgatggagcgttatttggacttatgatgcctttcgtcaagcgtgcaccaaaggtt
tctttcaagaagcctatcggaagtgtgagtgtttctggtcacaagtttgttggctgtcca
atgccatgcggtgttcagctaacaaggttggaacacattaatgttctctcaaggaacgtc
gagtaccttgcttcaagggatgccacaatcatggggagccgcaatggtcacgctcctatc
ttcctttggtacaccctcaacagaaaaggttacagaggattccagaaagaagtacagaaa
tgtctcagaaatgctcattacttgaaggatcgcctacgtgatgctgggattagtgcaatg
ttgaatgagttgagcagtactgttgtgtttgagcggcctagagatgaggagtttgttcgt
aggtggcaactagcttgccaaggaagtattgctcatgtggtggtgatgcccaatgtcact
attgagaagctggataatttcttgaatgaattaattgagaagcgctcaacatggtaccag
gatggacaacttcagtctccttgtattgcaactgatgttgggagtgagaattgtgcttgt
gctttgcataagtga

DBGET integrated database retrieval system