KEGG   Jatropha curcas: 105631576Help
Entry
105631576         CDS       T03922                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
jcu  Jatropha curcas
Pathway
jcu00450  Selenocompound metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105631576
Enzymes [BR:jcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     105631576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS Methyltransf_31 PrmA Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_32 Met_10 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 105631576
NCBI-ProteinID: XP_012069132
UniProt: A0A067L0Y5
Position
Unknown
AA seq 1087 aa AA seqDB search
MAAFVSMDDFLKNCEQSGDAAYAAFRSLLERLEDSKTRKEARIFLSDLHKRVGDSDQCLQ
KYHFRIQDIFLDQFEGYQGRKKLTMMVIPSIFMPEDWSFTFYEGLNRHPESIFKDRTVAE
LGCGNGWISIALADKWLPSKVYGLDINPRAIKISWINLYLNALDENGQPIYDAEKKTLLE
RVEFHESDLLAYCRDNDIQLERIVGCIPQILNPNPDAMSKMITENASEEFLHSLSNYCAL
QGFVEDQFGLGLIARAVEEGIAVIKPMGIMIFNMGGRPGQAVCKRLFERRGFHVSKLWQT
KVIQAGDTDISALVEIEKNSPHRFEFFMGLSGDQPICARTAWAYGKAGGRIAHALSVYSC
QLRQPNQVKKIFEFLKNGFQEVSSSLDLSFVDDSVADEKIPYLAYLAGELKEQSCFPYES
PAGSKRFRNLIAGFMKTYHHVPLSSNNVVIFPSRAVAIENTLRLFSPRLAIVDEHLTRHL
PRQWLTSLAIEGTENYDPSKDTITVIEAPRQSDLMVELIKKLKPQVVVTGMAQFEAVTSS
AFIQLLDITREIGSRLFLDISDHLELSSLPSPNGVLKYLSGARLPSHAAILCGLVKNQVY
SDLEVAFVVSEEEAIFKALSKTVEVLEGNTAPIRQFYYGCLFHELLAFQLADRRPLAERE
CEKAKSVEAIGFSSSAISVLNDSELSITEEEKSSLIHMDADQSFLPIPSTVKAAIFESFA
RQNMAESEVDVTPSIKQFIKSNYGFHTDNNTEFVYADFSQALLNRLILCCIQEGGTFCFP
AGSNGNYVSAAKFLKANILSIPTDSASGFKLTDKLLNEALNTVNKPWVYISGPTINPTGL
LYNNKEMESILTTCAKFGARVVIDTSFSGLEFDLEGWGGWNLEATLSKLNASANPSFSVS
LLGGLSLKLLSGVLKFGFLVLNNPTLVDAFYSFPGLSKPHSTVKYAIKKLLGLDESKARD
LTDDVAEQTRNLKSRSQRMKETLEKCGWEVLEPCGGVSMMAKPAAYLNKVIKIKHSPEDG
AGNAAPYEIKLNDSNIRDAIVKSTGLCINSGLWTGIPSYCRFTIALEENDFERALNCIIK
FKDLISN
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtttgtctcaatggatgatttcttgaaaaactgtgagcaatctggtgatgct
gcatacgctgcgttcaggtcattgttggagcggttggaggattcgaagactcgaaaggag
gcccgaatcttcctttcggatctccataagcgtgttggcgactccgatcagtgtctccag
aaataccattttcggatccaagatatcttcttggaccaattcgaaggttatcaggggaga
aagaaattgacaatgatggttatcccaagcatttttatgcctgaagactggtccttcact
ttttatgagggactgaatagacatcctgagtcaatcttcaaggacagaacagtcgctgag
cttggttgtggaaatggatggatatccattgcgcttgcggacaagtggttgccttcaaag
gtgtatggccttgatattaaccctagagcaataaagatttcctggatcaatttgtattta
aatgctttggatgaaaatggtcaacccatctatgatgcagagaagaaaactttactggag
agggtggaatttcatgaatctgatctacttgcttattgtagagataatgacattcaactt
gaacgaattgttgggtgcataccacagattcttaacccaaatccagatgcaatgtctaaa
atgattactgaaaatgctagtgaagaatttctgcattcattgagcaactactgtgcactt
cagggctttgttgaggatcagtttggcttaggtctaattgccagggctgttgaggaagga
atagctgtcatcaagcctatggggattatgatttttaacatgggtggccgtccaggacaa
gctgtttgtaaacgtttgtttgaacgccgtggatttcatgttagcaagctttggcagact
aaagttattcaggctggtgacacagatatatcagccctagttgaaattgagaagaacagt
ccgcaccggtttgagtttttcatgggtctttctggagatcagccgatttgtgctcgaaca
gcatgggcttatgggaaggctggtggtcgcattgctcatgctttatcagtttacagttgt
caacttcgccaaccaaaccaggttaaaaaaattttcgagtttcttaagaatggcttccag
gaggtcagcagttctttagatttgtcttttgtggatgattctgttgctgatgagaagatt
ccatacctcgcttatcttgctggtgaattgaaagaacagtcatgtttcccttatgagtca
ccagctggaagcaaacgatttcgcaatctaattgcaggctttatgaaaacgtatcaccat
gttccactcagttccaataatgtcgtcatatttccttcaagagctgttgcaattgaaaat
actcttcgattgttctcacctcgtcttgcaattgttgatgaacatctgactcgacactta
cctcggcaatggttaacttcgttagcaattgagggtacagaaaattatgacccttcaaag
gatacaatcacagttattgaagcaccaagacagtctgatttaatggtagagctgataaag
aagctcaaaccacaggtggtggtcactgggatggctcaatttgaggctgtaactagttca
gcatttattcaacttttggatattactagagaaattggatctcgtcttttcttagacata
tctgatcaccttgagctatccagccttccgagtcccaatggagtcctaaaatatctttca
ggagctcgtctaccttcacatgctgcaatcctttgtggcctcgtaaagaaccaggtttat
tcagatttagaagttgctttcgtcgtttcagaagaagaggccatttttaaggccttgtcc
aagacagtcgaagtactagaaggaaatactgcacctatcaggcagttttattatggctgt
ctttttcatgagcttctggcatttcagcttgcagaccgacgtccacttgcagagagagaa
tgtgaaaaggccaaatcagttgaggcaattgggttttcaagttccgctatttcagtcctc
aatgattctgagttgtcaattactgaggaagaaaaatcttccttgattcacatggatgca
gatcaatccttcttgcctattccatctactgtaaaagcagcaatcttcgaaagttttgca
aggcagaacatggctgaatcagaagtcgatgttacccctagcatcaagcaattcattaag
agcaattatgggttccatactgacaacaacacagagtttgtctatgcagacttctcacaa
gccctgcttaatagactgatcctctgctgcatccaagaaggaggaacattttgcttccca
gctggctcaaatgggaactatgtgtctgctgccaagtttttaaaagcaaacattttgagt
atcccaactgactctgcatcaggtttcaagctgacagacaagctactcaatgaagcgctt
aatactgtaaataagccatgggtgtatatttctggtccaacaattaaccctactggcttg
ttgtacaacaataaagagatggagagcatattgactacttgtgcaaaatttggggcacga
gttgtcattgatacttcattctcaggattggaatttgatctggaaggttggggtggttgg
aatttagaggcaacattatcaaagttgaatgcctctgccaacccttctttttctgtgtct
ttgcttggaggactttctcttaagcttctaagtggagtactcaaatttgggtttttggtt
ttaaacaatcccactttagtggatgcattttatagctttccaggattaagcaaacctcat
agcactgttaaatatgctataaagaagttgttgggcttggatgagagtaaggcaagagac
cttacagatgatgttgcagaacaaacaagaaatttgaaatccagatcccagcgcatgaaa
gagacactagagaaatgcgggtgggaagtgcttgaaccctgtggtggtgtttctatgatg
gcaaagcctgctgcctacctgaacaaggtcattaaaatcaagcattccccagaagatggt
gctggaaatgctgctccatatgaaatcaagctcaatgactcaaatattagggatgctata
gtgaagtcaacaggtttatgcatcaacagtggcttatggactggaattcccagctactgc
cgcttcacaattgctttggaagaaaatgatttcgagcgagcattgaattgcataattaaa
tttaaggatctcattagtaactaa

DBGET integrated database retrieval system