KEGG   Jatropha curcas: 105631605Help
Entry
105631605         CDS       T03922                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
jcu  Jatropha curcas
Pathway
jcu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105631605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jcu03041]
    105631605
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105631605
Spliceosome [BR:jcu03041]
 Complex C
  Other components
   Step II factors
    105631605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-RING_2 zf-C3HC4_2 AAA_22 zf-C3HC4 zf-RING_UBOX AAA_19 ABC_tran AAA_29 AAA_30 DAP3 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 105631605
NCBI-ProteinID: XP_012069167
UniProt: A0A067KXQ1
Position
Unknown
AA seq 1736 aa AA seqDB search
MIPYSQNNHPFTRHRQFRPPPHSPHLFHLRPHYDHQHNHQQNQKRNRLFGVKLLPNRPCQ
QQEQRQHNNGGRTLSIETLVAECNPKPCRFNTSSSGKPIASLFFQQQADALDAYVSFWER
RLAGDHFFNPEVDFKVGEDVRERLKRVFKFYAEKKVLEGETVKKLEGKVNELSVAIDEFS
GLLRKPKSLRTYVEIEARKQHLHDERDGIVNRIEEFKGAVKCILDYLDGKEVEELAVLGF
KNWKGFNWNKIHFFLLRECRRLENGLPIYGFRREILQQMHLQQVMILVGETGSGKSTQLV
QFLADSGVAASGSILCTQPRKLAAISLAKRVCEESIGCYDDNSIICYPTYSSTQYFNSKV
IYMTDHCLLQHLMEDKTLSGVSCIIVDEAHERSLNTDLLLALVKELLIGRPDLRLIIMSA
TVDSGKLSEYFFGCGIFHVLGRSFPVEIKYVPGSSGGSSGPNNISPYVSDVIRMAVEIHR
VEKEGAILAFLTSQLEVEWACEKFQSPSAITLALHGKLSHEEQCRVFQNYPGKRKVIFAT
NLAETSLTIPGVKYVVDSGKVKESRFEPTSGMNLLRVSKISQSSANQRAGRAGRTEPGKC
YRLYSEFDYQEMAVHQEPEICKVHLGIAVLRILALGIKNVLEFDFIDAPSSKAVDLALKN
LVQLGAVACRNDAFELTLYGHNLVKLGIEPRLGKIILESCHYGLRKEGVVLAAVMANASS
IFCRIGTNDDKQKSDCFKVQFCHCDGDLFTLLTVYKEWESVPPDNRNKWCWNNSINAKTM
RRCKETVLELENCLENELNIIIPTYWIWSPDVFTEHDKNMKKIILSSLADNIAMYSGYDR
LGYVVVSSGEYIQLHPSSSLQVYSQKPDWVVFAELLSISSQYLVCATAVDFDSLSAFSPP
LFDLSKVQSRKVQLKLIKGFGSAVLKRFCGKTNNSLLSLISRIRTDFMDERISVDINVDD
NEILLYASAHDMEKVYGLVNDALKYEVKWISDECLEKCLYHGGRAGVSPPVALFGAGAEI
RHLELESRYLSVDVFLSNANGLDDKDLLKFFEKSVHGVCSFHRYAGSGQVGDEMEKWGRV
TFLTPEAARKALEFNDFELSGSLLKLSPARSSVGGSNKLSSFAALKAKVTWPRRNSRGHA
VVRCERNDAKFVVQDCFNLLIGGRLVFCELSTKDINCVIIRGLDRDTSEQEILEVLQMST
KRRILDVFLIRGDAVDNPPLSACEEALLKEIAPFMPNQGPLSNYCHVQVFPPQPKDTYMK
AYITFDGRLHLEAAKALQHIQGKVLAGCFSWQKLRCQQVFHSSVSCPASVYAFIERQLNS
LLKRFKNRPGVCCSLERNENGSYRVKISANATKTVAELRRPLEQLMNGKTVTHGSLTPSV
LQLLFSREGKFLMKSLQQEMGTYILFDRHNLSVRIFGPENRLALAEQKLVKSLLALNDNK
QIDIRLRGRAMPHDLMKKVVEKFGPDLCGLKAQFPDTAFMLNTRHHVISFFGKEDLRLRV
EATINDFARSLSVGGASKQPVDGPTSCPICLCEIEDCYQLEGCGHKFCRTCLVDQLESAM
RGHDGFPIRCAQEGCRLHILLTDLKSLLPCEKLEDLFKASLGAFVASSGGTYRFCPSPDC
PSVYRVSTTGMVGAPFACGACYAETCTKCHLEYHPYVSCERYKEFKEDPDLSLVDWRKGK
EHVKSCPECGSIIEKVDGCNHIECRCGKHICWVCSESFNSSDDCYGHLRSIHLAII
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atgattccttactctcagaataaccaccctttcacgcgccaccgccaattccgccctcca
cctcactctccacaccttttccacctccgtccccactacgaccaccaacataaccaccag
caaaaccaaaaacgaaaccgtctatttggtgttaagcttttacccaaccgcccctgccaa
caacaagaacaacgacaacataacaatggtggccgtacactttcaattgagactttagtt
gcagaatgtaatcctaagccttgcaggtttaacaccagttcatctggtaagccaattgcc
agccttttttttcaacagcaggctgacgctttggatgcctatgtttccttttgggagcga
cggcttgcgggggaccacttttttaatccggaagtcgattttaaagtcggcgaagatgtg
cgtgagagactgaaaagggtgttcaagttttatgcggagaagaaggttttagaaggtgag
acagtgaagaaattggaggggaaagtaaatgaattgtccgttgcaattgatgagttttca
ggcttgcttagaaagccaaagagtcttcgtacttatgttgagattgaagcaaggaagcag
catttgcatgatgagagggatgggattgtgaatagaattgaggagtttaagggtgcagtg
aagtgtattttggattatctcgacggtaaggaggttgaggagttggcggttttggggttt
aaaaattggaagggttttaattggaataaaattcattttttcttattgagagaatgtagg
cggcttgaaaatgggctgcccatatatggttttagaagggagattttgcagcaaatgcat
ttgcagcaggtaatgatcttggttggagagacaggttcagggaagagtacgcagttggta
cagtttcttgctgattcaggggtcgctgccagtggttcaattttatgtactcagcctcgc
aaacttgctgcaatttccttggcaaaaagggtttgtgaagagagtattggatgttatgac
gataattcaatcatctgttatccaacatattcatccactcagtattttaattccaaggta
atatatatgacagatcactgtctattgcagcaccttatggaagataagactttgtctgga
gtttcatgcatcattgtagatgaggctcatgaaagaagcttgaatactgatcttttgttg
gccttggttaaagaattgcttattggaaggcctgacctgaggcttattataatgtctgca
acagttgattctgggaaattatcagaatacttctttggttgtggaatatttcatgtatta
ggcagaagttttcctgttgaaatcaaatatgttcctggttcctctggaggatcttctggt
cccaataatatttctccatatgtttctgatgtcatcaggatggccgtcgagatccatcgg
gtagagaaagagggggcaattcttgcatttttgacttctcagctggaggtagaatgggct
tgtgaaaagtttcagtctccctcggccatcacattggcattacatggaaagctttcccat
gaagagcaatgtcgtgttttccagaattatcctgggaagagaaaagttatttttgctaca
aatttggcagaaacatccttgaccattccaggggtcaagtatgtggttgattctggaaag
gttaaagaaagcaggtttgaacctacctctggtatgaatctcctaagagtttccaagatt
agccagagttctgctaatcaacgagctggtcgtgctggtcgaacagaacctggcaagtgt
taccggctttactcagaatttgattatcaggaaatggctgttcatcaggaacctgaaatt
tgtaaagttcatcttggcattgcagttttgagaattcttgctttgggtattaagaatgtg
ctagaatttgattttattgatgctcccagttctaaggcagttgacttggccctcaagaac
cttgtgcagttaggtgctgttgcctgcagaaatgatgcttttgaattaactttatatggg
cataacttggttaagttgggtattgaaccccgactcgggaagattattcttgaaagctgc
cattatggtttgcgaaaagagggagttgtgcttgctgctgttatggcaaatgcaagtagc
atattttgtagaattggtactaatgatgacaaacagaaatctgattgctttaaggtgcaa
ttctgccactgtgatggagatctcttcacgttgcttactgtctacaaggaatgggagagt
gtacctccagataatagaaataaatggtgttggaacaatagcatcaatgccaaaaccatg
cgcagatgcaaagagacagtgctggagttggagaactgtttggaaaatgaacttaacatc
atcattccaacttactggatatggagtcctgatgttttcacagaacatgataaaaatatg
aagaagatcatactttcctcactagctgataacatagccatgtactctggatatgatcgt
cttggttatgtggttgtttcaagtggagaatacattcaactgcatccttcaagttcatta
caggtgtatagtcaaaagccggactgggttgtctttgctgaactcttatctatctccagt
caatatctggtctgtgctactgctgttgactttgatagcttgtctgcctttagtcctcct
ctatttgacctctcaaaggtacagagtagaaaagtgcagttgaagttgatcaaaggattt
ggaagtgctgttttaaaaaggttctgtgggaagacaaataatagcttgctttctcttatt
tctcgtatacgaacagatttcatggatgagcggataagtgttgatatcaatgtggatgat
aatgagattcttttatacgcatctgcacatgacatggaaaaggtttatggccttgttaat
gatgcattaaaatatgaagtaaaatggataagtgatgaatgccttgagaaatgcttgtac
catggggggcgggctggtgtgtctcctccagttgcgctttttggggctggtgcagaaatt
aggcatctggaattggaaagtagatatttgagtgtagatgtattcctttcgaatgcaaat
gggctagatgataaagatttattaaaattctttgagaaatctgtgcatggggtatgtagt
tttcacagatatgctggcagtggacaggttggtgatgaaatggagaagtggggtagggtg
acatttcttactcctgaagcagctagaaaagctttagagttcaatgactttgagttatct
ggctctttacttaagttgtcccctgctaggtcatctgttggaggtagtaataaactgtca
tcatttgctgctttaaaagccaaagtcacttggccaagaaggaacagcagagggcatgcg
gttgttcgatgtgaaaggaatgatgctaagtttgttgttcaggattgctttaatctgttg
attggaggcaggttagttttttgtgagctcagcacaaaggacataaactgtgttatcatt
agaggattggatagagatacttctgaacaagaaattcttgaagttctgcaaatgtccaca
aaaaggagaattttggatgtatttctgatacgaggagatgctgtagataatcctcctctt
agtgcttgtgaggaagcacttctcaaggaaattgctccatttatgcctaaccagggccct
ttgagcaattactgtcatgttcaggtcttcccacctcagccaaaggatacttacatgaag
gcttacatcacctttgatggaagattacatttggaggcagcaaaagctttgcaacatatc
caagggaaggtacttgctggttgtttttcatggcagaaattgcggtgccagcaggttttc
catagctctgtatcatgtcctgcttctgtttatgcattcattgagaggcagcttaactct
ttactcaaaaggtttaagaatcgacctggtgtttgttgcagtttagagaggaatgaaaat
ggttcctatagagtgaagatatctgctaatgcaacaaagacggtggcagagttgaggagg
ccactggagcagctaatgaatggaaagacagtaactcatggcagccttaccccatcagtt
ttgcagcttctcttctctagagaaggcaaatttctcatgaaatcgttgcagcaagaaatg
ggaacttatattctctttgataggcacaacctcagtgttcggatatttggtccagagaac
cgacttgctcttgcggaacagaaattggtaaaatcccttttagccctcaatgataacaag
caaatagatatccgtcttcgaggtagagctatgcctcatgaccttatgaaaaaggtggtt
gagaagtttggtcctgatttgtgtgggcttaaagcacagttccctgatactgcatttatg
cttaacacaaggcaccatgtcatctctttttttggcaaagaggatctgaggctgagagtg
gaagctacaattaacgattttgctcgatcccttagtgttggtggagcttccaagcagcca
gttgatgggcctacttcctgccctatttgcttgtgcgaaattgaggactgttaccagctt
gagggttgtgggcataaattctgtcggacatgcttggttgatcagttagagtcagcaatg
agaggacatgatggtttcccaatacgctgtgcccaagaaggttgtaggttgcacattttg
ctcactgatttgaagtctcttctgccatgtgaaaagttagaggacctcttcaaggcttct
ttgggggcatttgttgcttctagcggtggcacttacaggttttgcccttctccggactgt
ccatcagtttatcgagtatcaaccacagggatggttggcgctccttttgcgtgtggagca
tgctatgcagagacatgtacaaagtgtcacttggagtatcacccatacgtgtcatgtgaa
agatacaaagaattcaaggaggatcctgatctgtccttggtagattggcgcaagggaaag
gagcatgtcaagagctgtccggaatgtggatccataattgagaaggttgatggctgcaac
cacattgagtgcagatgtggcaagcatatttgctgggtctgttcagaatcttttaacagc
agtgatgattgctacgggcacttgaggtcgatacatcttgctatcatatga

DBGET integrated database retrieval system