KEGG   Jatropha curcas: 105631806Help
Entry
105631806         CDS       T03922                                 

Definition
(RefSeq) zinc finger CCCH domain-containing protein 34
Organism
jcu  Jatropha curcas
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 105631806
NCBI-ProteinID: XP_012069378
UniProt: A0A067L7C5
Position
Unknown
AA seq 473 aa AA seqDB search
MDRYGRNQEGSQSDPSPEWTTPGPESGLEEGVWPLGLGEGESGYPERPDEANCIYYLRTG
FCGYGARCRFNHPRDRGAVIGAARAGAGEFPERVGQPVCQYYMRTGTCKFGASCKYHHPK
QEGGSVSPVSLNYYGYPLRPGEKECTYYVKTGQCKFGATCKFHHPQPANLQIVPQSPAPQ
VAPVPAPIPAPALYPSSVPSTQQYGLVVARPSLLPSSYVQGPYGPMLLSPGVVPYPSWSP
YPAPVSPVASPSTQPGVGSGSLYQLSPSAPAYTGAYQSMLSSVGPSSSSQKEPFFPERPD
QPECQYYMKTGNCKFGSSCRYHHPPELIAPKTNVVLSPIGLPLRPGAPPCTHYTQRGQCK
FGPACKFDHPMGTLSYSPSASSLADMPVAPYPVGSTIGTLAPSSSSSELRPELISGSSKD
SSSTRMSSSMSTSSGLVGSTFSKIGPVSHSGVQQSSQSSGASSSSSMEAHTSS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaccggtacggtcggaaccaggagggctcacagtccgatccgtcaccggaatggaca
accccgggacctgaaagcgggcttgaggagggtgtttggccgctgggattaggggaagga
gaatccgggtatccggagagacccgacgaggccaattgtatctattacttgaggaccggg
ttttgcgggtacggggcgaggtgtcggttcaatcacccgcgagaccgaggcgcggtaata
ggagctgcaagagctggtgctggggagtttcctgagcgagtcggccagcctgtgtgccag
tattatatgcggacagggacatgcaaatttggtgcttcctgcaagtaccaccatcctaag
caggaaggtggttctgttagtcctgtgtccctaaattattatggatacccattacgtccg
ggtgaaaaagaatgtacatattatgtaaaaacagggcagtgtaaatttggtgcaacgtgt
aaattccatcatccacagccagctaacttacaaattgtaccacaatcaccggctccccaa
gttgcacctgtgccagctccaattcctgctcctgcattgtatccttcatctgttccttct
actcaacaatatggactagtagttgcgaggccttctcttctgccgagctcttatgtacaa
ggtccttatggtccaatgctgctttccccaggtgtagttccctatccaagttggagtccc
tacccggcacctgtaagtccagttgcatctcctagcactcagccaggagttggatcaggc
tctttgtatcaactatctccttcagcacctgcttacacaggagcatatcagtccatgctt
tcttcagttggtccatcaagcagcagccagaaagaacccttttttccggaaagacctgac
caaccagaatgtcagtattatatgaaaactggcaactgtaaatttggatcttcctgtaga
tatcatcatccaccagagttgattgcaccaaaaacaaatgttgtacttagccctatcggc
cttcctttacgtccaggtgcaccaccttgtactcactatacgcaacggggacaatgcaag
tttggacctgcttgcaaatttgatcatccaatgggaacattaagttacagtccatctgca
tcttctcttgctgatatgcctgttgcaccttatcctgtgggttctacaattggtactcta
gccccatcatcctcatcttcggagttgcggcctgaacttatttcagggtcaagcaaggac
tccagttcgaccaggatgtcttcatcaatgagcacatctagtggattggtaggttcaact
ttttcaaagattggacctgtctcccattctggtgtgcaacagtctagccagagttctggc
gcttcatcaagcagcagcatggaggctcacacctcaagctaa

DBGET integrated database retrieval system