KEGG   Jatropha curcas: 105632894Help
Entry
105632894         CDS       T03922                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
jcu  Jatropha curcas
Pathway
jcu00730  Thiamine metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    105632894
Enzymes [BR:jcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     105632894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 NAD_binding_9 Lycopene_cycl GMC_oxred_N FAD_oxidored HI0933_like GIDA Pyr_redox_3 FAD_binding_3 RNA_pol_Rpb1_3 Pyr_redox Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 105632894
NCBI-ProteinID: XP_012070751
Position
Unknown
AA seq 357 aa AA seqDB search
MATMATALTSLSTKSSLFDSSAFYGTPVAAAPPSLRMQPTKSNGVSISMSANTPSSSVPQ
YNLNSFRFDPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPSVKV
AIVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDELDIEYDEADNYVVIKHAALFTSTIM
SKLLARPNVKLFNAVAAEDLIVKNGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSS
CGHDGPFGATGVKRLKSIGMIESVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEI
DGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGTFTIHPELMLAAAESADIADA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatggctacagctctcacatctctatccacaaagagctctctctttgattcc
tccgccttctatggcactccggtggctgcggcaccaccttctctccgcatgcaaccaaca
aaatcaaacggagtttcaatttctatgtcggcgaacacaccatcatcatccgttccacag
tacaatttgaacagttttagatttgacccaatcaaggaatccatagtgtcccgtgagatg
acgcgcagatacatgacagacatggtgactcacgccgataccgatgtagtgattgtaggt
gccggttctgctgggctctcatgtgcttatgagctcagtaagaatccatctgttaaagtc
gccatcgttgagcaatctgttagccctggtggtggcgcttggctcggtggccagctcttc
tctgccatgattgtaaggaaacctgctcatcttttcctggatgaactggacattgaatac
gatgaagcagacaactatgttgtaatcaagcacgctgccctgtttacctccacaatcatg
agcaagctccttgcccgtcctaatgtcaagcttttcaatgctgtggcggctgaggacttg
atagtgaaaaatggtagagttggtggggtggttaccaattgggctctagtgtcaatgaac
catgacacacagtcttgtatggaccctaatgtgatggaggctaaggtggttgtgagttct
tgtggccatgacggaccctttggtgccactggagtgaagagacttaagagcattggtatg
atcgagagtgttccaggaatgaaagctcttgatatgaatactgctgaagatgctattgtt
aggcttactagggagattgtgcctggaatgattgttactggcatggaagttgctgagatt
gatggtgctccaagaatgggaccaacatttggagctatgatgatatcagggcagaaagca
gctcaccttgccttgaaggcattggggctgcccaacgcgctcgatggaacattcaccatc
cacccagagttgatgcttgctgcagctgaatctgctgatatagccgatgcttga

DBGET integrated database retrieval system