KEGG   Jatropha curcas: 105633157Help
Entry
105633157         CDS       T03922                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
jcu  Jatropha curcas
Pathway
jcu00450  Selenocompound metabolism
jcu00970  Aminoacyl-tRNA biosynthesis
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105633157
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105633157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jcu01007]
    105633157
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jcu03016]
    105633157
Enzymes [BR:jcu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105633157
Amino acid related enzymes [BR:jcu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105633157
Transfer RNA biogenesis [BR:jcu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105633157
 Prokaryotic type
   Other AARSs
    105633157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 Viral_protease tRNA-synt_1e DUF3952
Motif
Other DBs
NCBI-GeneID: 105633157
NCBI-ProteinID: XP_012071110
UniProt: A0A067KT86
Position
Unknown
AA seq 804 aa AA seqDB search
MGDLSSNNTTGEVRTAPKVPIAGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCR
LRGYNAIYVCGTDEYGTATETKAMEENCTPKEICDKYHAIHKEVYKWFNISFDEFGRTST
PQQTEVCQTIFKKLLENNWLSENTMQQLYCDTCKRFLADRLVEGTCPTEGCNYDSARGDQ
CEKCGKLLNPTELKDPKCKVCRNTPRIRDTNHLFLELPLLKDKLVQYIENMSVAGSWTQN
AIQATNAWLKEGLKSRCITRDLKWGVPVPHEKFKDKVFYVWFDAPIGYVSITKCYTPDWE
KWWKNPENVELYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKS
KGIGVFGNDAKDTNIPVEVWRYYLLTNRPEASDTLFTWSDLQAKLNSELLNNLGNFINRV
LSFIAKPSGTGYGSIIPESPNADSHPLTKKLAQEVGKYVEQYVEAMEKVKLKQGLKTAMS
ISSEGNAYLQESQFWKLYKEDQPSCNIVMRTSVGLVYLLACLLEPFIPSFSLEVFKQLNL
SPEQASLSDEKGDIDKAKRPWEFVPPNHKIGPPEPLFKELKDEEVDFFRKKFAGSQAERA
EAEAAKVAEQLKKTKVSDSGKKQQTKKPAAQAKSKSTVEPEISITRLDIRVGLITKAQKH
PDADSLYVEEIDLGGETRTVVSGLVKYIPLEEMQNRKVCVLCNLKPATMRGIKSQAMVLA
ASNSDHTKVELGEPPASAAVGERVTFPGFEGEPDDVLNPKKKVWETLQVDLQTNADLVAC
YKDTPLTTSAGVCKVASIGSGSIR
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgggggacctctcgtcgaacaataccaccggagaggttcggacagcgccgaaggtcccg
atcgccggcaagagaaacatactcatcactagtgccttgccttatgtcaataacgttcct
caccttggcaatatcattggctgtgtattgagcgctgatgtttttgctcgatattgtcgt
cttcgaggatacaatgccatatacgtatgtggaactgatgagtatggaacagcaactgag
acaaaggcaatggaggagaattgtacacctaaagaaatttgtgacaagtaccatgcaatt
cacaaggaagtatataagtggtttaatattagttttgatgaatttggacgtacttcgact
ccacagcagacagaagtttgccaaacaatttttaaaaagttgttggagaataattggctt
tctgaaaacacaatgcagcagctttactgtgatacatgcaaaaggttcttagctgatcgg
cttgtagagggtacttgtcctactgaagggtgcaattatgattctgcacgaggagatcaa
tgtgaaaagtgtggaaagctgttgaatccaacagaattaaaagatcctaaatgcaaggtc
tgtcgaaacactccacgcattcgtgatacaaatcatttgtttctcgagcttcctctgcta
aaggataaattggtacaatatattgagaacatgtccgtagctggatcctggactcagaat
gctattcaggctacaaatgcatggttgaaagaaggactaaagtcacgatgtattactagg
gatctgaaatggggagttccagttccacatgagaaatttaaggacaaggttttctatgta
tggtttgatgcacctattggatatgtctcgatcacgaagtgttacactcctgactgggag
aagtggtggaagaatcctgaaaacgtggagctgtatcaattcatggggaaggataacgta
ccattccacactgtgatgtttccatctactcttcttggaactggtgaaaattggaccttg
atgaagaccataagtgttacggaatacttaaactatgaagcagggaagttttccaagagc
aaaggcataggagtttttggtaatgacgcaaaagatacaaacattcctgtagaagtgtgg
agatattatttattaactaacaggccagaggcatctgacacactatttacgtggtccgat
ttgcaagcaaaacttaacagtgagttgctcaataatttgggcaactttatcaatcgggtt
ttgagttttattgctaaaccttcaggcacaggatatggatccatcattccagaatctcca
aatgctgactcacatcccctgacaaagaaattggctcaagaagttggtaaatatgtggag
caatatgttgaagctatggagaaggttaaattaaagcaaggactgaaaactgcaatgagc
atttctagcgaagggaatgcatatttgcaagaaagccaattctggaagctttacaaagaa
gaccagccttcatgtaacatagttatgaggacctctgtaggacttgtgtatcttcttgca
tgtttattagaacctttcatcccatctttctctcttgaggttttcaagcagcttaatttg
tctcctgaacaagcttcactttctgatgaaaaaggagatattgataaggcaaagagacct
tgggagtttgtacctcccaatcataaaattggaccaccagagccattgttcaaagaattg
aaagatgaagaagtagatttcttcaggaagaaattcgctggaagtcaagctgagagggca
gaagctgaagcagcaaaggttgctgagcaactgaagaagacaaaagtttcagacagtgga
aagaagcaacagactaaaaaaccagctgcccaagccaaatcaaagagcactgtcgaacca
gaaatttcgatcacaagacttgatattcgtgttggtctaattacgaaagctcagaaacat
cctgatgctgattctctctatgtagaagaaattgatctgggaggagagactagaacagtc
gttagtggacttgtcaagtatatacctctagaagagatgcagaatcggaaggtctgtgtt
ctttgcaacttaaagccagcaaccatgaggggtattaagtcacaagctatggttcttgcc
gcttccaacagtgaccacaccaaggtggagttgggcgaaccacctgcatctgctgctgtt
ggagagagagttacattccctgggtttgaaggtgagcccgatgatgtcctaaaccctaag
aagaaggtttgggagacgctgcaagtggatctccaaactaacgcggatctagtagcgtgc
tataaggatactccattaaccacatctgctggagtatgcaaggttgcatccattggaagt
ggttcaatcaggtag

DBGET integrated database retrieval system