KEGG   Jatropha curcas: 105633238
Entry
105633238         CDS       T03922                                 

Definition
(RefSeq) alpha-copaene synthase
  KO
K22065  alpha-copaene/(+)-delta-cadinene synthase [EC:4.2.3.133 4.2.3.13]
Organism
jcu  Jatropha curcas
Pathway
jcu00909  Sesquiterpenoid and triterpenoid biosynthesis
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    105633238
Enzymes [BR:jcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.13  (+)-delta-cadinene synthase
     105633238
    4.2.3.133  alpha-copaene synthase
     105633238
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 105633238
NCBI-ProteinID: XP_012071204
Position
Unknown
AA seq 549 aa
MSAQVSAVPTSEVRRSSANYHPKIWEDRFFTRHDSDSEKIGIISSEEQFEGLREEVRRLL
SEGSPNLALIDAVLRLGIGYHFTSEIENALEKLHHHHCVTDSNDLYTVALQFRLLRQHGI
KVSSDIFEKFKDSEGKFKESLTHDAMGMLSLYEAAHLGIQGEDILDEAIDFTTTNLQLLL
PQLSSDLANEVSHALNRPIRKCLPRLEARHYIEVYKREKSHNSTLLKFAKLDFNRLQQLH
QKELRGISEWWKTLDVPTKLPYARDRVVECYFWMMGIYFEPKYSFGRRMMTKVIATLSLL
DDTYDNYGTGAELEILTEAIQRWNIKEKDTLPEYMKIIFNTVIDVYNEIEEFVTKEGRLY
CLHYLKEALKRVVRSYLAEAKWRDNGYVPTMEEFMDLQLITTCYPLLATTSFFGMGEIAN
KYAFEWISNDPKIVRASTIVCRLNILFYDITSHTFEQKREHAASGFECYIKQHGGSEEEV
EKLFRKEIGNGWKDINEECLKPTPVPMPLLERVLNLTRAMDVIYKDEDGYTNSHVIKDYV
ASLLKDPAV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtctgctcaagtttcagcagttcctacatctgaagttagacgatcttctgctaattat
catccaaaaatttgggaagatcgtttcttcacacgtcatgattcagactccgagaaaatt
ggcattatttcaagtgaagaacaatttgaaggactaagagaagaagtgaggagattgcta
agtgagggtagcccaaatttggctttgattgatgcagtcctacgcttaggcattggttat
cattttactagtgagatagaaaacgcattggaaaaacttcatcatcatcactgcgttact
gacagcaatgatctttacactgttgctcttcaatttcgtttgcttagacagcacggaatt
aaggtttcatctgatatttttgaaaaatttaaagatagtgaaggaaagttcaaagaatcc
ttaactcatgatgcaatgggtatgcttagtttatacgaggcagcacatcttggcattcaa
ggggaagatatcttagatgaagccatagatttcaccaccacaaacctccaattactatta
cctcaattaagttctgacctcgcaaatgaagttagccatgccctcaatcgacccatccgc
aaatgtttgccaaggttagaggcaaggcattatattgaagtctataaacgggagaaatca
cacaatagtacattactaaagtttgcgaagttagatttcaacaggttacaacaactacat
cagaaggaactacgtggcatctctgagtggtggaaaaccttggacgtaccaacaaagctg
ccttatgcaagagatagagtggtggagtgctacttttggatgatgggaatttattttgaa
cccaaatattcatttggaagaaggatgatgacaaaagtcatagccactttatccctactc
gatgatacttatgataactatggtacaggtgcagaactagagatccttaccgaagccatc
cagaggtggaatattaaggaaaaggatacacttccagagtacatgaaaattatttttaat
acagtaatagatgtctataatgaaatcgaagaatttgttactaaagaagggagattatat
tgcttgcattatttgaaagaagcacttaaaagagttgtccgatcttatttagctgaagcc
aaatggcgcgacaatggctatgttccaacaatggaggaatttatggaccttcaattaata
actacttgttatccattgctcgcaacaacttccttcttcggaatgggtgaaatagctaac
aaatatgcgtttgaatggatatctaatgatcctaagattgttcgagcttcgactattgtt
tgcagacttaacattttattctatgatataacatctcatacgtttgagcaaaaaagagaa
catgcggcttcgggctttgaatgttacataaagcaacatggtggttcagaggaagaggta
gaaaaattgtttcggaaagagattggaaatggatggaaagacataaatgaggagtgccta
aagccaactccagttcctatgcctctgttagagcgagttctgaatcttacgcgcgcaatg
gatgttatatacaaagatgaagatggatacactaattctcatgttataaaagattatgtt
gcttccctgcttaaagatcctgcagtttga

DBGET integrated database retrieval system