KEGG   Jatropha curcas: 105633445Help
Entry
105633445         CDS       T03922                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
jcu  Jatropha curcas
Pathway
jcu00350  Tyrosine metabolism
jcu00360  Phenylalanine metabolism
jcu00380  Tryptophan metabolism
jcu00950  Isoquinoline alkaloid biosynthesis
jcu00965  Betalain biosynthesis
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105633445
   00360 Phenylalanine metabolism
    105633445
   00380 Tryptophan metabolism
    105633445
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    105633445
   00950 Isoquinoline alkaloid biosynthesis
    105633445
   00965 Betalain biosynthesis
    105633445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jcu04147]
    105633445
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     105633445
    4.1.1.105  L-tryptophan decarboxylase
     105633445
Exosome [BR:jcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105633445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 105633445
NCBI-ProteinID: XP_012071418
UniProt: A0A067KRP2
Position
Unknown
AA seq 498 aa AA seqDB search
MGSPDSNLTETSQFKPLDPQEFRKQAHQMVDFIADYYQNIETYPVLTQVRPGYLHTRLPE
TAPYRPESFDTILSDVEKLIVPGMTHWLSPNFFAFFPATVSSAAFLGEMLCTCFNSVGFN
WLASPASTELEMIVMDWLGHMLNLPKSFMFSGSGGGVIQNTISEAILVTLCAARDRVLSK
TEANHLSNLVVYGPDQTHSTFQKACKLVGILPSNIRLLPTSLDTGFSLSPFTLRTAIEAD
MLSGLVPLYLCVTVGTTSTTAIDPIEPLAEVANDYGLWMHVDAAYGGSACICPEFRDYLN
GVERVDSLSLSPHKWLLSYMDCCCLWVKNPSLLIKALSTNPEYLKNKESESNSVVDFKDW
QVGTGRRFKSLHLWMILRSYGISNLQSHIRSDILMAKMFEEFVRSDPRFEIVVPRRFALV
CFRLVCPKKLDGSAHFEILNRKLLEWVNSTGRIYMTHTKVGGEYILRFAVGATLTEERHV
VAAWMLIKDGADVLFKSA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtccagactctaacttaaccgaaaccagccaattcaagcccctagaccctcaa
gaatttcgcaaacaagcccatcaaatggtagatttcattgcagattactatcaaaatatc
gaaacctacccggtacttacccaagtccgccctggctacctccatactcgcttgcctgaa
actgcaccttatcgtcccgagtccttcgataccattctcagtgatgttgaaaagctcata
gtccctggaatgactcattggcttagtccaaatttcttcgcattctttcctgctacagta
agcagtgcagcttttcttggagaaatgctgtgcacttgctttaactctgttggattcaat
tggcttgcttcgccggcttccactgagctagaaatgattgttatggattggcttggacat
atgcttaacctaccaaaaagcttcatgttctcaggttccggtggaggcgtgattcaaaat
acaatcagtgaagcaattcttgtaacactttgtgcagcaagagacagagttctctccaaa
acggaggccaaccatttgtccaatctcgtggtttacggccctgatcaaactcattcaacg
tttcaaaaggcatgcaaattagttgggatacttccctctaacataagattattacccacc
tcactagatactggattttctctatctcctttcactctccgcactgcgatagaagctgac
atgttgtctggtttggtcccactttacctttgtgttactgtggggacaacttcaactaca
gccattgatcccattgagcctcttgctgaggtggcaaatgattacggcttgtggatgcat
gtagatgctgcttatggtggcagcgcatgcatatgcccggagttcagggattacttaaat
ggggtagaacgagttgactcactgagtcttagtccacacaagtggctcctgagttatatg
gattgctgttgcttgtgggtgaaaaacccgagcctattgataaaggcattaagcacaaat
cctgagtacttgaagaacaaggaaagcgagtcgaactcagtcgtcgattttaaagactgg
caagtgggtacaggtcggagattcaagtcgctccatttatggatgatattgcgtagctat
ggcatctctaatctccaaagtcacattagatctgacatcctgatggctaaaatgtttgaa
gagtttgtaagatccgacccgcggttcgaaattgtggtgccgagaagatttgcgctcgtg
tgcttccggttggtatgcccgaaaaagttggacgggtcggctcacttcgagattctgaac
cggaagcttttagagtgggtgaactcgacaggtcgaatttatatgacgcatacaaaagta
ggaggagagtacatattgagatttgcagtgggggctacacttactgaggaacggcacgtg
gttgccgcgtggatgttgataaaggacggagctgatgtgttgttcaagagtgcatga

DBGET integrated database retrieval system