KEGG   Jatropha curcas: 105634402Help
Entry
105634402         CDS       T03922                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
jcu  Jatropha curcas
Pathway
jcu00906  Carotenoid biosynthesis
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Module
jcu_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    105634402
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     105634402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 105634402
NCBI-ProteinID: XP_012072644
UniProt: A0A067KNL6
Position
Unknown
AA seq 623 aa AA seqDB search
MVGSHRPRVAFKSCVKSLYVVVVVEKGNQMDAFSSSFLSTVPPSKLFLTHKTTPTSFPLP
LLNVSSVRIEEKPQTTTSTTTTTTRTSSTKPSSSPSTINISAATAKRRVEPSLPTMVFNA
FDGIINNFIDPPLKPGVDPGHVLSDNFAPVDELPPTDCEVIEGSLPSCLDGAYIRNGPNP
QYLPKGPYHLFDGDGMLHSIRISQGKAKLCSRYVKTYKYIKERDAGAPLLPNVFSGFNGL
AASAARGALSAARILSGQFNPANGIGLANTSLAFFGNRLYALGESDLPYVVRLTPNGDIE
TVGRHDFDGKLFFSMTAHPKIDLETGETFAFRYAPIPPFLTYFQFDSNGNKQADVPIFSM
VRPSFLHDFGISKKYAVFADIQIGMNPVEMIFGGGSPVGLDPTKVPRIGIIPRYAKDESE
MRWFDVPGFNLIHAINAWDEEDAVVILAPNILSAEHTLERMELVHALVEKVRIDLKTGIV
TRNPVSARNLDFAVINPAYVGKKNKYVYAAIGDPMPKITGVVKLDVSKGDRRECTVAARI
YGERCYGGEPFFVARQPENPEAEEDDGYLVSYVHDEINGESKFLVMDAKSPNLDIVAAVK
LPRRVPYGFHGLFVKESDLKKLY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggttggttctcacaggccgcgagtagcctttaaaagctgtgtaaaatccctttacgtt
gttgtggttgtggagaaaggtaatcaaatggatgccttttcttcttcttttctctcaact
gttccaccttcaaagctctttctcacccataaaacaacaccaacttcatttccattacct
cttcttaatgtctcatctgttagaattgaagaaaaaccccaaaccacaacctcaactact
actacaactactagaactagttcaactaagccatcttcatcaccttcaaccattaatatt
tctgcagcaacagcaaagagaagagtagagccttctctacctactatggtcttcaatgca
tttgatggcataatcaacaatttcatagatcctccactcaagcctggggtggatcctgga
catgtactttccgacaactttgctccggtcgatgagcttcctcctactgactgtgaggtg
atagaagggtctctcccatcatgcctcgacggtgcatacattcgcaacggtcccaatcca
cagtaccttccgaaagggccttaccacctatttgatggagatggtatgcttcactctatt
agaatctctcaaggcaaggccaaactctgcagccgctatgtcaagacttacaagtacatc
aaggagcgcgacgctggtgctcctcttcttccaaatgtgttttctgggttcaatgggctc
gcagcctctgcagcgcgcggtgctctttcagccgctagaattctttccggtcaatttaat
cctgcaaatggcattggtttagcaaacactagccttgctttctttggtaatagactgtac
gcactaggtgaatctgacttgccttatgtcgtccgtttgactccgaatggggatatcgag
actgttggtcgccatgattttgacggcaagttattcttcagcatgactgcccatcccaag
atagaccttgaaacaggcgagacctttgcatttcgatatgctcccataccgccattttta
acatactttcagttcgattcaaatggaaataagcaagcagatgtgcctatattttcaatg
gttcgcccgtctttcctccacgactttggaatcagcaaaaaatatgcagtatttgctgac
atacaaataggaatgaacccagtggagatgatattcggaggaggctctccggtgggattg
gaccctacaaaagtaccgagaatcggaatcattcctcgctatgcaaaagacgagtcagaa
atgagatggttcgatgtgcctggctttaatctgatacacgcaattaacgcatgggatgaa
gaagacgcagttgtaatattagcaccaaacatattatcagcagaacatacgcttgaaaga
atggaacttgtccatgctttggtagagaaagtcagaatagacttaaaaactggcatagta
acaagaaatccagtttcagctagaaatcttgattttgcggtgataaatccagcttatgtg
gggaagaagaacaaatatgtatacgcagcgataggtgatccaatgccaaaaataacaggg
gtggtcaaattggatgtatctaaaggggaccgccgtgagtgcacggtggccgctagaatt
tacggtgaaaggtgctatggtggtgagcccttctttgtggcaagacaacctgaaaaccca
gaagctgaggaggatgatgggtatttggtgtcatatgttcatgatgagataaacggagag
tctaagttcttggtaatggacgcaaagtccccgaatcttgatattgtggcagccgttaaa
ttgccacggcgagttccttatggcttccatggactttttgtgaaggaaagtgacctcaaa
aagctctactaa

DBGET integrated database retrieval system