KEGG   Jatropha curcas: 105635125Help
Entry
105635125         CDS       T03922                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
jcu  Jatropha curcas
Pathway
jcu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105635125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jcu03041]
    105635125
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105635125
Spliceosome [BR:jcu03041]
 Complex C
  Other components
   Step II factors
    105635125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind S1 Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD AAA_16 ABC_tran PhoH AAA_14
Motif
Other DBs
NCBI-GeneID: 105635125
NCBI-ProteinID: XP_012073505
UniProt: A0A067KY08
Position
Unknown
AA seq 1183 aa AA seqDB search
MATTTTKTREDDGLKKLEYLSLVSKVCTELESHLGFGDKVLAEFITELGRNCESVDEFDS
KLKENGAEMPDYFVRTLLTIIHAILPPKPKSEKDSKDKDCASLSDTKKSKFKALAIADSK
ERAKELERELHMEAGERRKEQKRDEEDRNKDRDWRDKDRHRDRDNRHRDKDRDYNDDRGG
DYSSSGRRRDRHDRHRRDGSEENGYHYRDDGENERGRRHARYNSGEPELYKVYKGRVSRV
MDSGCFVQLNELRGKEGLVHVSQIASRRVGNAKDVVKRDQEVYVKVISVSGQKLSLSMRD
VDQNSGKDLLPLKKNSDDDDAFRTNPSGSKDGPITRTGLSGIRIMEEDDAVPSRRPLKRM
SSPERWEAKQLIASGVLGVKEYPMYDDEADGLLYQEEGAEEELEIELNEDEPAFLQGQTR
YSVDMSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMP
ETGERHLAQELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELI
QAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFG
CRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTD
VLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESD
YLDAALITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYDRMKGLGKNVPELIILPVYSA
LPSEMQSRIFEPPPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLV
ITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTTVPEIQRINLGNITLTMKAM
GINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLA
SVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAK
NFSGPWCFENFVQSRSLRRAQDVRKQLLSVMDKYKLDVVSAGKNFTKIRKAITAGFFFHA
ARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVVDPKWLVE
LAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atggctaccacaacaacaaaaacgcgagaggatgatggtcttaagaaactggaataccta
tcgctcgtatccaaggtttgcacagagctcgaatctcacttaggatttggagacaaagta
ttggctgagttcatcaccgaattgggacgaaattgcgagagtgttgatgaatttgattca
aagttgaaggaaaacggcgctgaaatgccggattactttgtccgtacactactcactatc
attcatgccatccttccgcccaagcccaagtctgagaaggattccaaagataaagactgc
gcctcactctctgatacaaaaaaatccaagttcaaagctcttgctattgctgatagtaag
gagagagccaaggaactcgaacgagaactccatatggaagctggggagagaaggaaagaa
cagaaaagggatgaggaggataggaacaaagacagagactggagagataaggataggcac
agggatagagataacaggcatagagataaagatagggactataatgatgatagaggtggt
gattatagtagtagtggaaggcgccgagataggcatgacaggcataggagagatgggagc
gaagaaaatggttatcactacagggatgatggcgaaaacgaaaggggtcggaggcatgct
cgatataattccggtgagcctgaattgtacaaggtgtataagggcagggtgtcgagagtt
atggactctggttgttttgtgcaattgaatgaacttaggggcaaagaggggttggtccat
gtttcacagatagcaagtaggagggttggtaatgccaaggatgttgtgaagcgagaccag
gaggtttatgttaaagtgatttcagtttctggacagaagttgagtctttccatgagagat
gttgatcagaatagtggtaaggatttgcttcctttgaagaagaattcagatgatgatgat
gcttttaggactaatccttcaggttccaaggacgggccaattactagaactgggctttct
gggataaggattatggaggaggatgatgctgttccatcacgtcgaccactgaagagaatg
agctcaccagagaggtgggaagcaaaacaattgattgcttctggagttttaggtgtcaaa
gaatatcctatgtatgatgatgaagcagatgggctgctttatcaagaagagggagccgag
gaagagcttgaaattgagttaaatgaggatgagcctgcttttttgcaaggtcagactagg
tactcggttgatatgtcaccagttaagatttttaagaatcctgaaggatcattgagtcgt
gcagctgcacttcagtctgcgctcataaaggagaggagagaagtaagggaacaacaacag
aggactatgctcgattcaataccaaaggatcttaatcgtccttgggaagacccaatgcct
gagactggtgagaggcatcttgctcaggagcttagaggtgttggcttgtctgcttatgac
atgcctgaatggaagaaggatgcatttggaaaggcattaacatttgggcaaagatcaaaa
ctatccattcaggagcagaggcagagcttgccaatatacaaattgaaaaaggaactaatt
caagctgtacatgataatcaggttttggtggttattggtgagacaggttctggtaagact
acccaggtaacacagtatcttgctgaggcaggttatactacaaggggtaagattggatgt
actcagcctcgccgggtggctgcaatgtctgtagccaagagggtggctgaagagtttggt
tgtcgtttaggggaggaggttggatatgccattcgttttgaggactgcactggaccagat
actgtgatcaaatatatgacggatggtatgctattaagggagattcttattgatgaaaat
ctttctcagtactcagtgataatgcttgatgaagctcatgagaggacaatccacactgat
gttctttttggattacttaaacagcttgtgaagaggagacctgatctgcgcttgatcgtc
acatctgccacgctggatgcagagaaattttcagggtatttcttcaactgtaacatattc
acaatccctgggagaacttttcctgtggagatattatacaccaaacagccagaaagtgac
tatttagatgcagctttgatcactgttctacaaatccacttgacggaaccggaaggtgac
attcttctattcttgactggtcaggaggagattgattttgcttgccagtctctctatgac
aggatgaaaggattaggtaaaaatgttcctgaattgattatattgcctgtttatagtgct
cttcccagtgagatgcagtccagaatatttgaacctccccctccagggaagcggaaggtg
gttgtggcaacaaatattgctgaggcttctttgacaattgatgggatattttatgtcatt
gatcctggttttgcaaagcagaatgtatataatccaaagcaaggtcttgattctctggtc
ataactccaatttcacaagcatctgcgaagcagcgtgctggacgtgctggacgcactggg
cctggaaagtgttatcgtctgtatactgaaagtgcttatcgtaatgagatgtcccctacc
actgttccagaaattcaaagaataaatcttggaaatattacactcacaatgaaggcaatg
ggaattaacgatctattgtcttttgattttatggatcccccttcaccacaggccctcatt
tctgccatggaacagctatacagtctaggagccttggatgaagaggggcttctgaccaaa
ctgggaagaaaaatggcagaatttccccttgatccgccattgtccaagatgttgctggca
agtgtagatctggggtgcagtgatgagattttgactattattgccatgatccaaactggt
aacatattctacaggcctagagaaaaacaagcgcaagcagatcagaagagagctaagttt
ttccagccggagggagaccatttgaccttacttgctgtgtatgaagcttggaaagctaag
aacttttcagggccatggtgttttgagaattttgttcagtcaagatccctgaggagggca
caggatgttaggaaacagctcctctcagtgatggataaatacaaactggatgttgtgagt
gctggaaagaatttcacgaagataagaaaagcaattacagctggcttctttttccatgct
gctagaaaggatccacaggagggttataggactctggtggagaaccaaccagtttatatc
cacccaagcagcgctcttttccagagacagccggactgggtcatataccatgaactggta
atgactacgaaggagtacatgcgtgaggtaactgttgtagatcccaaatggcttgtggaa
ctggcgcctagattctttaaagtggcagatccaactaaaatgagcaagcggaagcgtcaa
gagcgaattgagcccctatacgacagatatcatgaacctaattcatggcgattaagtaaa
cggcgggcttaa

DBGET integrated database retrieval system