KEGG   Jatropha curcas: 105636005Help
Entry
105636005         CDS       T03922                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
jcu  Jatropha curcas
Pathway
jcu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105636005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:jcu03012]
    105636005
Translation factors [BR:jcu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    105636005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 105636005
NCBI-ProteinID: XP_012074557
UniProt: A0A067KLP9
Position
Unknown
AA seq 927 aa AA seqDB search
MASRFWGQGGSDSEEEESDYEEEVDNEAGDSTTQAPQNRYLRGTASDSDDSDDQKRVVRS
AKDKRFEEMSATVDQMKNAMKINDWVSLQESFDKINKQLEKVMRVTESDKVPSLYIKALV
MLEDFLNQALANKEAKKKMSSSNAKALNSMKQKLKKNNKQYEDLINKFRENPESEEEQEA
DEETEEEEDSDLEFVEDPSKIAVSDEDEEDEEDRQDGRTEVEGDWQKMLSRKEKLMDRQF
MKDPSEITWDTVNKKFKEVVAARGRKGTGRFEQVEQLTFLTKVAKTPAQKLEILFSVVSA
QFDVNPGLSGHMPINVWKKCVHNMLIILDILVQYPNIVVDDMVEPDENETQKGADFDGTI
RVWGNLVAFLEKIDSEFFKSLQCIDPHTRDFVERLQDEPMFLVLAQDVQEYLERAGDFKA
ASKVALRRVELIYYKPQEVYDAMRKLAEQTDDGDGVKSGEVEESRGPSAFVVTPELVPRK
PTFPESSRTMMDMLVSLIYKCGDERTKARAMLCDIYHHALLDEFSTSRDLLLMSHLQDSI
QHMDISTQILFNRAMAQLGLCAFRVGLITEGHGCLSELYSGGRVKELLAQGVSQSRYHEK
TPEQERLERRRQMPYHMHINLELLEAVHLICAMLLEVPHMAANTHDAKRKVISKTFRRLL
EVSERQTFIGPPENVRDHVMAATRALTKGDFQKAFDVIKSLDVWRLLKSKDSVLEMLKAK
IKEEALRTYLFTYSSSYESLSLDQLTKMFDLSGTQTHSVVSKMMINEELHASWDQPTQCI
IFHDVAHSRLQLLAFQLTEKLSVLAESNERAIEARVGGGGGLDLPVRRKEGQDYASMAAA
GGKWQDSYTPGRQGSGRSGYNVGGGRPPALGQATGGGYSRGQSRTGGYSGGSRYLDGAYG
GSGRTSARGSQLDGSNQMVSLNRGVRA
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcgattctggggacagggcggaagtgactctgaggaggaagagagtgattat
gaagaagaggttgataatgaggctggtgactctaccacccaagccccacaaaacagatat
ctcagaggaacagctagtgatagtgatgattctgatgaccaaaagcgtgtcgtcagatcg
gcgaaagacaaacgttttgaagagatgtcagctactgttgatcaaatgaagaatgcaatg
aagattaatgattgggtcagtttgcaagagagctttgacaaaattaataaacagcttgag
aaggtcatgcgggtgacagaatctgataaggtcccatccctttacatcaaagctctagtg
atgttagaggatttcttgaatcaggctttggcaaataaggaagctaagaaaaagatgagc
agtagtaatgctaaggccttgaactcaatgaaacagaaactgaagaagaacaataaacag
tacgaggatttgattaataaatttagggagaatccagagagtgaggaggaacaggaggca
gatgaggagactgaagaggaggaagactcggatttagagtttgtagaggacccttcaaag
attgcagtgtctgatgaggatgaagaggatgaggaagatcgccaggatggtcgaacagag
gttgaaggtgactggcagaagatgttgagcaggaaagaaaaactcatggataggcagttt
atgaaagatcctagtgaaatcacatgggatacggtaaacaaaaagttcaaagaggttgtt
gctgctcgaggtaggaagggaactggacggtttgagcaggttgagcaactaactttcttg
acaaaggttgccaagacccctgcacagaagcttgagattctttttagtgtggtttctgcc
caatttgatgtgaatccaggattgagtggtcatatgcctataaacgtatggaagaagtgt
gtgcataatatgctgattattctggatattctcgtccagtatcctaacatcgtcgtggat
gatatggttgagcctgatgagaatgaaacccagaagggggcagattttgatgggacaatt
cgggtttggggtaacttggtggctttccttgagaagatagattcagagttcttcaagagt
ttgcaatgtattgatccacacacaagggactttgttgagaggctgcaggatgaaccaatg
tttttggtccttgctcaagatgtccaagagtatctagagcgtgctggggactttaaagct
gcatcaaaggttgccctaaggcgcgttgagttgatctattacaaaccccaagaggtttat
gatgccatgaggaaactggctgaacaaacagatgatggtgatggtgtgaagtcaggagag
gttgaggaaagtaggggtccctctgcctttgtagtcactcctgagcttgtgcctcgaaag
cctactttccctgagagtagcagaacaatgatggatatgcttgtctctctgatatataaa
tgtggagatgagagaacaaaagctcgtgcaatgctttgtgatatctaccaccacgctctc
ctagatgagttctcaacttcccgtgacttgttattaatgagtcacctacaggatagtatc
cagcacatggatatttcaactcagattctcttcaacagggctatggcacagcttggtttg
tgtgcattccgtgttgggctaatcactgaaggacatggttgcctttctgaactgtattct
ggtggaagggtgaaggagttgcttgcacaaggtgtttcacaaagtcgttaccatgagaag
actccagaacaggaaaggctggaaaggagacgccagatgccatatcatatgcatatcaat
cttgagcttctggaggctgtgcaccttatttgtgcgatgctactggaggtcccccacatg
gcagccaacacacatgatgcaaaacgcaaagtcattagcaagacatttaggcgtttgctt
gaggttagtgagaggcaaactttcataggtcctccagaaaatgtgagggatcatgtgatg
gcagcaactcgtgctcttaccaagggggatttccagaaggcttttgatgttatcaagtct
cttgatgtctggaggctccttaagagcaaagacagcgttcttgagatgctcaaagccaag
attaaggaagaagctcttaggacgtacctatttacctactcctcctcttatgagtcactt
agcttggaccagctcaccaaaatgtttgacctctcaggaacccaaactcatagcgttgtt
agcaaaatgatgatcaatgaggagcttcacgcaagttgggaccagccaacacagtgcatc
atcttccatgatgttgcgcactcaaggttgcagcttctggcattccagttaactgagaag
ctgtcagttcttgctgaaagtaatgagagggcgatagaggcaagagtcggtggtggtggt
ggtttggatctgcctgtgaggcggaaagagggccaggattatgctagcatggctgctgca
ggtggcaagtggcaagactcttacactccgggaaggcaaggttcagggcgttcaggatat
aatgttggtggtggcagaccaccagcactaggccaagctactggtggtggctattcaaga
ggtcagtcacgaacaggtggatactcaggcgggtcaaggtatctagatggtgcatatggt
ggttcaggaaggacttctgcaaggggatctcagttggatggttcaaatcaaatggttagt
ctcaacaggggggttcgtgcatag

DBGET integrated database retrieval system