KEGG   Jatropha curcas: 105636278Help
Entry
105636278         CDS       T03922                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
jcu  Jatropha curcas
Pathway
jcu03040  Spliceosome
jcu04141  Protein processing in endoplasmic reticulum
jcu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105636278
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105636278
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105636278
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:jcu01009]
    105636278
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jcu03041]
    105636278
   03009 Ribosome biogenesis [BR:jcu03009]
    105636278
   03110 Chaperones and folding catalysts [BR:jcu03110]
    105636278
   04131 Membrane trafficking [BR:jcu04131]
    105636278
   03051 Proteasome [BR:jcu03051]
    105636278
   03029 Mitochondrial biogenesis [BR:jcu03029]
    105636278
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jcu04147]
    105636278
Protein phosphatases and associated proteins [BR:jcu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105636278
Spliceosome [BR:jcu03041]
 Complex B
  Other components
   Prp19 complex
    105636278
 Complex C
   Prp19-CDC5 complex
    105636278
Ribosome biogenesis [BR:jcu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105636278
Chaperones and folding catalysts [BR:jcu03110]
 Heat shock proteins
  HSP70 / DNAK
   105636278
Membrane trafficking [BR:jcu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105636278
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105636278
Proteasome [BR:jcu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105636278
Mitochondrial biogenesis [BR:jcu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105636278
Exosome [BR:jcu04147]
 Exosomal proteins
  Proteins found in most exosomes
   105636278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 105636278
NCBI-ProteinID: XP_012074911
UniProt: A0A067KKT3
Position
Unknown
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA
EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDAVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYSYNMRNTVKDEKIGAKLSPADKKKIEDAIEAAIQWLDSNQLAEADEFED
KMKELESICNPIIAKMYQGAGGDMGGAAMDDDAPAGASGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaagggagagggtccggcgatcggtatcgatctcggtaccacatactcgtgt
gttggtgtatggcaacatgatcgtgttgagatcattgctaatgatcaaggaaacagaacg
acgccatcttatgttgcttttactgatacggagcgcttgatcggtgatgctgctaagaat
caagtcgccatgaatccaatcaacaccgtttttgatgcaaagaggttgattggaaggaga
ttcactgatgcctctgttcagagtgacatcaaattatggcctttcaaggtcatttctggt
cctggcgataagcccatgattgttgtttcatacaagggtgaggaaaagcaatttgctgct
gaagagatctcttctatggtccttataaaaatgcgtgagattgcagaggcttatcttggt
tccacagtgaaaaatgctgtggttactgtccctgcctacttcaatgactcacagcgtcag
gctaccaaagacgctggagtaattgctggccttaatgtgatgcgtattataaatgagccc
acggctgctgctattgcctatggtcttgacaagaaggccactagtgttggtgaaaagaat
gttttgatttttgatcttggaggtggtactttcgatgtgtctctactcacaattgaagag
ggtatatttgaggtgaaagccacagctggagatacacatcttggtggtgaagattttgat
aataggatggttaaccactttgtccaagagttcaagagaaagcacaagaaggacatcagt
ggaaaccccagagcccttaggaggctcaggacatcctgtgaaagggcaaagagaactctc
tcatcaactgcacagaccaccattgaaattgactccttgtatgagggtattgacttttac
tccaccatcactcgagccagatttgaggaacttaacatggatttatttagaaaatgtatg
gaaccagttgagaagtgtttgagggatgccaagatggacaagagcactgtacacgatgct
gtgcttgttggtggttctactaggattcctaaggtccagcagcttttgcaggacttcttt
aatggaaaggaactttgcaagagcatcaaccctgatgaggctgttgcttatggtgctgcg
gtccaagcagctatcctgagtggtgagggtaatgagaaagttcaggaccttcttttgttg
gatgtcactcctctttcccttggtttagaaactgctggtggcgtcatgacagtgttgatt
cccaggaacactaccattcccaccaagaaggaacaagtattctctacctactcagacaac
cagcctggtgtgttgattcaggtatatgaaggagaaagaacaaggacaagggataacaac
ttgcttggtaaattcgagctctctggcattccccctgctcccaggggtgttccacaaatt
acagtgtgcttcgacattgatgcaaatggtatcttgaatgtgtctgctgaggacaagacc
actggccagaagaacaagatcaccattaccaatgacaagggaagactctcgaaggaggag
atcgagaagatggttcaagaggcagaaaagtacaagtctgaggatgaagaacacaaaaag
aaggttgaggctaagaatgcattggaaaattactcgtacaatatgaggaacacagtgaag
gatgagaagattggtgccaagctttctccagctgacaagaagaaaatagaagatgcaatt
gaggctgctatccaatggcttgacagcaaccagctagctgaggctgatgagtttgaagac
aagatgaaggagttggagagcatatgtaacccaatcattgctaaaatgtatcagggtgct
ggaggtgacatgggtggtgctgccatggatgatgatgctcctgctggtgcaagcggtgct
ggccccaagattgaggaagttgactaa

DBGET integrated database retrieval system