KEGG   Jatropha curcas: 105636595
Entry
105636595         CDS       T03922                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
jcu  Jatropha curcas
Pathway
jcu00100  Steroid biosynthesis
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Module
jcu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    105636595
Enzymes [BR:jcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     105636595
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 105636595
NCBI-ProteinID: XP_012075300
UniProt: A0A067KTZ4
Position
Unknown
AA seq 369 aa
MDMGFLLHALIPSWNSVVVLAFFFFYLAIAGSILPGKVVPGVTLQDGSRLYYRCNGLVSL
LLLVALLGIGAKMDLVSPTVISERGLELLSATFIFSVLVAMVLYAAGCNSQNHGSSLKPH
VTGNLIHDFWFGIQLNPHFLGIDLKFFFVRAGMMGWLFINLSVLAKSIQDANLSCSMILY
QIFCGLYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLGNKVELT
MAAVIANCFVFLIGYLVFRGANKQKHVFKKNPKALIWGKPPRVVGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGTSSLVPYFYPIYLLILLIWRERRDEARCAEKYKEIWAEYRRLV
PWRILPYFY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatatgggttttcttcttcacgccctcattccttcatggaactcagtcgttgtacta
gcatttttctttttttatctggctattgctggatctatattgcctggtaaagttgttcct
ggagtgaccctgcaggatggttctcgtctctattatcgttgcaatgggttggtatcgttg
ctgttgctggtcgctcttcttgggattggcgctaagatggatcttgtatcacccactgtg
atatcagagagaggacttgagctgctttcagcaacttttattttcagtgttcttgtggcg
atggtactctacgctgctggttgcaattcacaaaaccacggttcttcgcttaagcctcat
gttacagggaacctaatacatgatttctggtttggaatacagctcaatcctcatttcttg
ggcattgacctcaagttcttttttgttagagctggaatgatgggctggctatttatcaac
ctatcagttttagcaaaaagtattcaggatgccaacttgagctgttcaatgattctttac
caaatattctgtgggttatacatcctggattacttcttttatgaggaatacatgacctcc
acatgggacataatagcagagagattgggcttcatgctagtatttggtgatcttgtttgg
attccattcacgtttagcatccagggttggtggcttttgggaaacaaagtggagttaaca
atggctgctgtaatagcaaattgctttgtttttctgattgggtatctggtctttagagga
gctaacaagcaaaagcatgttttcaaaaagaatccaaaagccctcatatggggtaagcca
ccaagggttgttggtggaaaattgcttgcttctggttattgggggattgcaagacattgt
aattatcttggagacctattgttggcgctgtcatttagtctaccttgtgggacaagttcc
cttgttccatatttttatccgatttatcttcttattctgctaatatggagagagagaagg
gacgaggctcgatgtgccgagaagtataaagaaatatgggctgaataccggagacttgtt
ccttggagaatactgccttatttttattaa

DBGET integrated database retrieval system