KEGG   Jatropha curcas: 105637888Help
Entry
105637888         CDS       T03922                                 

Definition
(RefSeq) translation machinery-associated protein 22
Organism
jcu  Jatropha curcas
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1
Motif
Other DBs
NCBI-GeneID: 105637888
NCBI-ProteinID: XP_012076942
UniProt: A0A067KNI1
Position
Unknown
AA seq 196 aa AA seqDB search
MAEKPQPVRVLYCSVCSLPAEYCEFGPDFAKCKPWLIQNAPDLYPDLIKEANAKEADKVA
DQLQSTGISSGGAAATPSGSTSASKEEEVKRLPGGKIKKKEKQEVVIEKVTRNKRKCITT
VKGLDLFGVKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDIAYDIVDFITDTWPDVP
ETAIYFIEDGKKVPAT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagccccaacctgtccgcgttctgtattgctcagtttgcagtttacccgca
gagtactgcgaattcggccccgatttcgcgaaatgcaagccctggttgatccaaaacgcc
cctgacctgtaccccgatctcatcaaagaggcaaatgccaaagaagctgataaggttgcc
gaccagttacaatccactggtatctcatcgggcggtgctgctgctactccttcagggagt
acttctgcttctaaagaggaagaagtgaaacgtcttcctggtgggaagataaagaagaaa
gagaagcaagaagttgttattgaaaaagtcacacgtaacaagaggaaatgtatcaccact
gtgaaagggctggacctgtttggtgttaaacttagtgatgcatcaaagaaacttgggaaa
aagtttgctactggagcctctgttgttaagggtccaactgagaaggagcagattgatgtg
caaggagacatagcctatgatattgtggacttcattacagatacctggcctgatgtccca
gaaactgcaatttattttattgaagatggtaaaaaagtcccagcaacttga

DBGET integrated database retrieval system