KEGG   Jatropha curcas: 105638136Help
Entry
105638136         CDS       T03922                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1 isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jcu  Jatropha curcas
Pathway
jcu00052  Galactose metabolism
jcu00500  Starch and sucrose metabolism
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105638136
   00500 Starch and sucrose metabolism
    105638136
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105638136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 105638136
NCBI-ProteinID: XP_012077268
UniProt: A0A067KD76
Position
Unknown
AA seq 576 aa AA seqDB search
MAASFVLGLLCLLFINGVKTVPSHQEVKNFQSQTFVAPETQPYRTSYHFQSPKNWLNDPN
GPMWYKGFYHLFYQYNPHSALFGNGMVWAHSVSSDLVNWVHLNHALYPSEPFDITSCWSG
SATILPGDIPVILYTGIDANNTQVQNLAIPKNLSDPFLEDWVKYSQNPLMTPPVGVEADN
FRDPTTAWLGPDGKWNVIVGSWSNNQGMAILYQSGDFINWRKYKDPLYSTERSGMWECPD
FFPVSINGTNGVDASVLNPTVKHVLKASFNSHDYYMIGAYVPETEKYIPDSDLTGTVTDL
RYDYGKFYASKSFFDSVKNRRILWGWVNESDTPDDDIKKGWSGLQAIPRQIWLDRSGNQL
VQWPVEEINKLHDKQINIENKILDNGSTFEIQYITASQADVEIVFELPELEEAEFFNPTW
VDPQKMCTDANAAVKGRLGPFGLLALATKDLTEQTAIFFRIFKGHNAYVVLMCSDQSRSS
LRDEVDRTTYGAFVNINPQHEKISLRSLIDHSIIESFGGKGRTCITSRVYPKFAVNKDAH
LYVFNNGTLSVTISRLNAWGMNKAEIENKESFNALF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagttttgttcttggattgttatgtcttctgtttattaatggagttaaaact
gtgccatcacaccaagaagtcaagaattttcaatctcaaacttttgtagcgccagaaacc
cagccttatagaacttcctaccactttcaatctccgaagaactggcttaacgatcccaat
ggcccaatgtggtataagggattttatcatcttttttaccaatacaatccccacagtgct
ctatttggtaatggtatggtatgggcacactctgtatcaagtgacttggtcaattgggtt
catctaaatcatgccctttacccatcagaaccatttgacatcactagttgctggtctggt
tctgctacgatccttcctggggatatacctgttattttatacactggtattgatgccaat
aatacacaggtccaaaacttagcaatacccaaaaatctttctgacccatttcttgaagac
tgggtaaaatattctcaaaatcctctcatgactccacctgttggtgttgaagctgacaac
tttagagacccaacaactgcttggttgggtcctgatgggaaatggaatgtgattgttgga
agttggagcaataatcaaggaatggcaattttgtatcaaagtggagattttattaattgg
aggaagtataaagatccactttattcaacagaaagatctgggatgtgggagtgtccagat
ttctttcctgtgtctattaatggcacaaatggtgttgacgcttcagtcctaaatccaact
gtgaagcatgttttgaaggcgagcttcaattctcatgactactacatgataggagcttat
gtccctgagacagaaaaatatattcctgactctgatttaacaggtaccgtaacagatttg
aggtatgactatggaaagttttatgcttcaaagtcgttctttgatagtgtcaagaataga
aggatattgtggggctgggtaaatgagtctgataccccagatgatgatatcaaaaaagga
tggtctggacttcaggcaattcctaggcaaatatggcttgatagaagtggaaaccaatta
gtacagtggccagtggaggaaattaacaaattacatgataagcaaattaatatcgaaaat
aagatacttgataatggatcaacattcgaaattcaatacataactgcttcacaggcagat
gtagagattgtatttgaattgccagaattagaagaggctgagttcttcaaccctacttgg
gttgatccccaaaaaatgtgtacagatgcaaatgcagctgtcaaaggtagattggggcca
tttggtttgttagctttagcaacaaaggacttgacagagcaaactgcaatattctttagg
atttttaaaggtcataatgcatatgtagtacttatgtgcagtgatcaaagcaggtcttct
ctaagagatgaggttgatagaaccacatatggagcttttgtcaacattaatccccaacat
gaaaagatttcattaagaagcttgatagatcactcgataattgagagttttggtgggaaa
ggtagaacttgtattaccagcagagtttatcccaagtttgctgttaacaaagatgctcac
ctgtatgtatttaacaatggaactctgagtgtcacaatctcaaggttgaatgcttgggga
atgaacaaagctgagatcgagaataaagaaagttttaacgcattattttga

DBGET integrated database retrieval system