KEGG   Jatropha curcas: 105638190Help
Entry
105638190         CDS       T03922                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
jcu  Jatropha curcas
Pathway
jcu00970  Aminoacyl-tRNA biosynthesis
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105638190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:jcu03029]
    105638190
Enzymes [BR:jcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     105638190
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     105638190
Mitochondrial biogenesis [BR:jcu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    105638190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 105638190
NCBI-ProteinID: XP_012077343
Position
Unknown
AA seq 146 aa AA seqDB search
MKQIQLKKIKEIKMGSKALLLLKIPTPLQRHQIILNYGRRYSTRSTTNVSSLQPPDLPRL
AETARISLAPNEVEEFAPKIRQVIDWFGQLQAVDLNSVEPAIRADSEGENLRDDIPETYD
KREAAIAGVPSYEDPYIKVPKVLNKE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatccaattgaagaagataaaagaaatcaaaatgggaagtaaggctctgtta
ctgcttaaaataccaacgccactccaaaggcatcagataattttgaactacggacgaaga
tactcaacacgatcaacaactaatgtgtcatctcttcaacctccagatttgcctcgtttg
gccgaaactgctcgaatttctcttgctcccaatgaggtcgaagaatttgctcccaaaatt
cgacaagtaattgattggtttggacaacttcaagctgtcgatcttaatagtgttgaacct
gcaataagagcagatagcgaaggtgaaaacttgcgtgatgatattcctgaaacatacgac
aaaagggaagctgcaattgctggtgttccaagctatgaagacccttatatcaaagttccc
aaagttttgaacaaggagtaa

DBGET integrated database retrieval system