KEGG   Jatropha curcas: 105639447Help
Entry
105639447         CDS       T03922                                 

Definition
(RefSeq) beta-hexosaminidase 3
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
jcu  Jatropha curcas
Pathway
jcu00511  Other glycan degradation
jcu00520  Amino sugar and nucleotide sugar metabolism
jcu00531  Glycosaminoglycan degradation
jcu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
jcu00604  Glycosphingolipid biosynthesis - ganglio series
jcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    105639447
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    105639447
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    105639447
   00604 Glycosphingolipid biosynthesis - ganglio series
    105639447
   00511 Other glycan degradation
    105639447
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:jcu03110]
    105639447
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     105639447
Chaperones and folding catalysts [BR:jcu03110]
 Intramolecular chaperones
  Others
   105639447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b Glyco_hydro_10
Motif
Other DBs
NCBI-GeneID: 105639447
NCBI-ProteinID: XP_012078913
Position
Unknown
AA seq 533 aa AA seqDB search
MMMGKGKVQLLLLLVGLAAILGCGGANANDFNVWPMPKSVTSGHNKLYMSPDFQLITQGS
SYSDASGILKDGFARMLNIVKIGHAPYANSSVHLPSQSLLLKGLRVLVFSSNDQLQYGVN
ESYKLLVPSHDKSYAQLEAQTVYGALHGLQTFSQLCYFNFTTSMVEVPMVPWTIIDQPRF
PYRGLLIDTSRHYLPLPVIEKVIDSMAYAKLNVLHWHIVDTQSFPLEIPSYPKLWNGAYS
ISERYTFADAAEIVSYAQRQGIHVLAEIDVPGHALSWGKGYPSLWPSKDCKQPLDVSNEF
TFKVIDGILSDFSKVFKFKFVHLGGDEVDTSCWSSTSRIQKWLEKHGMNASQAYQYFVLR
AQKIALSHGYEIINWEETFNNFGNKLSRKTVVHNWLGGGVAKQVVAAGLRCIVSNQDKWY
LDHLDTSWEKFYMNEPLANINDTEQQQLVIGGEVCMWGEMVDGSDIEQTIWPRAAAAAER
LWTPYDKLAKDPTHVTRRLAHFRCLLNQRGVAAAPLAGPGRGAPEEPGSCYSQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggggaaggggaaggttcagcttctgttacttttggttggactggctgctatt
cttggctgcggaggagccaatgcgaatgactttaatgtctggccaatgcctaaatcagtc
actagtggccacaacaagctttacatgtctccggattttcagctcatcactcaggggagt
agctacagcgatgcttctgggattttgaaggatggcttcgccagaatgcttaatattgtc
aaaataggccatgccccttatgccaattcctccgtccaccttccttctcaatctctcctc
ctcaaaggtcttcgcgtcctcgttttctcttcaaatgaccagttacaatatggtgttaat
gagtcttacaagttactagtcccttcacatgacaagtcatatgcacagcttgaggcacag
acagtttatggggctttacatgggcttcagacatttagccaattgtgctatttcaacttc
acaacgagcatggttgaagttcctatggtcccatggactatcattgatcagccaagattc
ccctaccggggactcttgattgatacttcacggcactatctgcctttgccagttattgag
aaagtgattgattctatggcctatgcaaaattgaatgttttacactggcacattgtagat
acacaatctttccctttggagataccttcatatccaaaactgtggaatggtgcctattca
atttcagagcgatacacttttgctgatgctgctgaaattgtcagttatgcccagaggcaa
ggaattcacgtattggctgaaattgatgttcctggacatgcactctcatgggggaagggt
tatccttctttatggccatcaaaggattgtaagcagcctcttgatgtgagcaacgagttt
acattcaaagtgatagatggaattctttcagatttcagtaaggtctttaaatttaaattt
gttcacttgggaggtgatgaagttgacacaagttgttggagttcaacttctcgcatacag
aaatggttagaaaagcatggtatgaatgcatctcaagcttatcagtactttgtcctgagg
gcgcagaaaatagctctgtctcacggatatgaaattatcaactgggaagaaaccttcaac
aattttggcaataaattgagccggaaaaccgtggtgcacaactggcttggtggtggtgtt
gctaagcaagtggttgctgctgggttgaggtgcattgtgagcaaccaagacaaatggtat
ttagatcacttggatactagttgggaaaaattttatatgaatgaaccacttgcaaatatc
aatgacactgagcagcagcagttggttattgggggtgaggtatgcatgtggggagaaatg
gtagatggatcggatattgaacagaccatatggccacgcgctgcagcagccgcagaacgg
ctatggacaccttatgacaagcttgcaaaggatccaacacatgttactagaaggttagca
cacttcaggtgtctgttgaatcaaagaggagtagcagcggctccattagctggacctggt
cgaggagcacctgaagaaccaggctcttgctactcacagtag

DBGET integrated database retrieval system