KEGG   Jatropha curcas: 105639825Help
Entry
105639825         CDS       T03922                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
jcu  Jatropha curcas
Pathway
jcu00020  Citrate cycle (TCA cycle)
jcu00640  Propanoate metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
jcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105639825
   00640 Propanoate metabolism
    105639825
Enzymes [BR:jcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     105639825
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     105639825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 105639825
NCBI-ProteinID: XP_012079379
UniProt: A0A067LBG3
Position
Unknown
AA seq 341 aa AA seqDB search
MTRQAVAKLFGSIASRKPSPSSFSLSSSATQTRQYAAAAAAPPPPAVFVDKNTRVICQGI
TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPP
FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKI
GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIERF
LVDPQTEGIILIGEIGGTAEEDAAQLIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSG
GKGTAQDKIRTLREAGATVVESPAKIGVAMLDIFKQRGLVS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcaagccgttgccaaactattcggctcgatcgcatcacgcaaaccctctcct
tcctcgttttcgctatcgtcgtcggctactcagactcgacaatatgctgcggcagcggct
gcacctcctcctccggcagtatttgttgacaagaacacccgagtgatatgccaaggtatc
actggcaaaaatggtacctttcacaccgagcaagccatcgaatacggcactaagatggtg
gggggcgtaacaccaaagaagggaggaacagaacacttgggcctccctgtttttaataca
gttgcagaagcaaaggctgaaacaaaagctaatgcttcagtcatttatgttcccccacca
tttgcagcagcagcaattatggaggcaatggaagcggagttagatcttgttgtgtgcatt
acagagggaattcctcaacatgatatggtacgtgtgaaggctgctcttaataaacagtcc
aaaactcggttgattggtccaaactgccctggtatcattaaacctggggaatgtaagatt
ggcataatgcctgggtacatacataaacctggtcgcattggaatagtttctcgatctggt
actttgacctatgaagcggttttccaaacaactgctgttggccttggacaatctacttgt
gttggtatagggggtgatcctttcaatgggacaaacttcgttgattgcattgaaaggttc
ttggtagatccacagacagaaggcatcattcttataggagagattggagggactgctgaa
gaagatgccgcacagctaattaaggaaagtgggactgacaagcctgttgttgcatttatt
gctggactaactgctccacctggccgtcggatggggcatgctggagccattgtctcaggt
gggaagggtacagctcaagacaaaatcaggaccctaagagaagctggagctacggtggtc
gagtctcctgcgaaaattggagttgccatgcttgatatttttaagcagagaggcctggtg
agttag

DBGET integrated database retrieval system