KEGG   Jatropha curcas: 105640275Help
Entry
105640275         CDS       T03922                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
jcu  Jatropha curcas
Pathway
jcu04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:jcu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    105640275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:jcu04131]
    105640275
   03029 Mitochondrial biogenesis [BR:jcu03029]
    105640275
Membrane trafficking [BR:jcu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    105640275
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    105640275
Mitochondrial biogenesis [BR:jcu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    105640275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1 PALB2_WD40 TolA_bind_tri zf-C4H2
Motif
Other DBs
NCBI-GeneID: 105640275
NCBI-ProteinID: XP_012079939
UniProt: A0A067KGM4
Position
Unknown
AA seq 509 aa AA seqDB search
MFREEIAREAINHALKALRKRHLLEEVAHAPAYTALSRPIISHGSEWKEKAENLELELQQ
CYKAQSRLSEQLVVEVAESRASKALLEEKEAALTDLQKELIQTRDECSQLRADLEEKIKA
LELVVSENHELRTQLEEMIVKAKNAEAENKMLVDRWMLQKMQDAERLNEANALYEEMVDR
LKASGLERLARQQVDGVVRQNEDGAEYFVESTVPSVCKHKITAHEGGCASIIFEYNSSKL
ISGGQDRSIKMWDTNTGSLSRTLYGCLGSVLDLCITHDNKSVIAASSSNNLYAWDAYSGR
VRHTLTGHIDKVCAVDVSKISSRHVVSAAYDRTIKVWDLQKGYCTNTIVFHSNCNSLCFS
MDGQTICSGHVDGNLRLWDIQTGKLLSEVAAHSLAITSICLSRNGNVILTSGRDNLHNLF
DMRSLEVCGTLRASGNRVASNWSRSCISPDDNYVAAGSADGSVYIWSVSKADIVSTLKEH
TTSVLCCSWSGLGKPLATADKNGIIYTWT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgggaagagattgcgagagaagctataaaccatgcgctaaaggccctaaggaag
cggcatttgcttgaagaagttgctcatgctcccgcttatactgctctttccagaccgatt
atctctcatgggtcagaatggaaggagaaagcagaaaatctggaattggaacttcagcaa
tgctacaaagctcaatctcgattgtctgagcaacttgttgtggaggtagcagagtccaga
gcatcaaaagctttactggaagaaaaagaagcagctttaactgatttgcaaaaggagtta
atacaaacaagggatgagtgctctcaattaagggcagatttagaagaaaagattaaggct
ctagaattggttgtaagtgagaatcatgaacttcgaacacaattggaagagatgattgtc
aaagctaagaatgcggaagccgaaaataagatgttagttgatcgctggatgctgcaaaag
atgcaggatgctgaacgtcttaatgaggccaatgctctatatgaagaaatggttgatcgg
ctcaaggcaagtggtttggagagactggctcggcagcaagtggatggagtggtccgacaa
aatgaagatggtgctgagtactttgtggaatcaactgttccatcggtatgcaagcacaaa
attacagctcatgagggtggctgtgcttctataatattcgagtataattctagcaaactg
attagcggtggacaggatcgctcaatcaaaatgtgggatacaaatactggatcattaagt
cgtaccctttatggttgccttggttctgttcttgatctatgcattacccatgataataaa
tctgtcattgctgctagtagctcaaataacttgtatgcatgggatgcctactcagggcgt
gtccgtcacactctcacagggcacattgataaagtgtgtgctgtggatgtcagcaaaatt
tcaagtcgtcatgttgtcagtgctgcttatgatcgtactataaaagtttgggatttgcaa
aaaggttactgcaccaacactattgttttccacagcaactgcaattcgctgtgctttagt
atggacggacagaccatttgttcgggccatgttgatgggaatcttcgcttgtgggatatt
caaacaggaaagctactcagtgaagttgctgcacattcacttgctattacatctatctgt
ctatcacgaaatggaaatgttatattgacaagtgggagagataacttgcataatttattt
gatatgagatctttagaagtttgtggtacattaagggcaagtggaaacagagtagcatct
aattggagtcgctcttgcatcagtcctgatgacaactacgttgctgctggatcagctgat
gggtctgtatacatttggtcagtatcaaaagctgatatagtaagcactctgaaggagcac
acaacttctgttctctgttgttcatggagtggacttggcaaaccgttagccacagcagac
aagaatggaattatttatacctggacatga

DBGET integrated database retrieval system